KEGG   Latimeria chalumnae (coelacanth): 102357941
Entry
102357941         CDS       T02913                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04020  Calcium signaling pathway
lcm04260  Cardiac muscle contraction
lcm04261  Adrenergic signaling in cardiomyocytes
lcm04270  Vascular smooth muscle contraction
lcm04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102357941 (CACNA1C)
   04020 Calcium signaling pathway
    102357941 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102357941 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102357941 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102357941 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102357941 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcm04040]
    102357941 (CACNA1C)
Ion channels [BR:lcm04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102357941 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ CAC1F_C PKD_channel GPHH DUF4034 DUF4834
Other DBs
NCBI-GeneID: 102357941
NCBI-ProteinID: XP_005989524
Ensembl: ENSLACG00000016558
LinkDB
Position
Un
AA seq 2178 aa
MTASAITHHEGSNYPSPHSSPHSNLNATTTAGLAPEHIPSSGAALSWQAAIDAARQAKLM
GNAGNATISTVSSTQRKRQQYSKQKKQGTTGANRPPRALLCLTLKNPIRRACISIVEWKP
FEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIGYGLLF
HPNAYLRNGWNLLDFIIVVVGLFSAILEQATKAEGVNPIGGKAAGFDVKALRAFRVLRPL
RLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYFTRDSF
PGIMAEEEPAPCALDSSHGRQCRNGTVCKPGWVGPNDGITNFDNFAFAMLTVFQCITMEG
WTDVLYWVNDAIGSGWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKL
REKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNMSMPASETESVNIDNVGANDL
EGENCCTQLVHRITKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTISSE
HYSQPNWLTQVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETI
LVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIII
FSLLGMQLFGGKFNFDEMVTRRSTFNNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSF
PGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKMARNCSP
EKKVENEKPMEDEEKKEEKIELKSITVDGDAQPTTKIAVEDYQLDGNEEKSSYPVNDFPG
EEEEEEPEMPVGPRPRPLSELQLKEKAVPMPEASAFFVFSSSNRFRIFCHRIVNDNIFTN
LILFFILLSSISLAAEDPVRHTSSRNQILFYFDIVFTIIFTIEITLKILGYADYVFTSIF
TLEITLKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISFGIQSSAINVVKILRVLRVLR
PLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFYRCSDGSKQ
TEAECRGQFIVYKDGDVAHPQLEKREWNNSNFHFDDILHAMMALFTVSTFEGWPTLLYQA
IDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDK
NQRQCVEYALKARPQRRYIPKNPYQYKVWYVVNSSYFEYLMFVLILLNTICLAMQHHGRS
SSFNDAMDVLNMVFTGLFTVEMVLKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEIN
HYFCDAWNTFDALIVVGSIVDIAITEVNPTEHATSSPNAMDSEDNSRISITFFRLFRVMR
LVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALDDESQINR
NNNFQTFPQAVLLLFRCATGEAWQEIMLACMPKRRCDPESESPNSSSDEDTSCGSSFAIF
YFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEANTVTSR
SFLTQSAGFSQARFVAMDKCFTLLEPVSTVQQPELMEVKLSRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKVPQKNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELD
KAMKENASAASEDDIFRRAGGLFGNHVNYYQSDGRGSFPQTFTTQRPLHINKTGTVPGDV
ESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCHFPSPANFQSTVSTVEGHTGTLPA
TLLQHGSSWKLNAKRSNSGDSRLPIICREETSPEETYDENFNQNTEYSSDQSIFSSEILS
YQDNEHKQLTPSEDCEAEEEEKARQSPKRGFLCAASLGRRSSFHLECLKRQRTQGMDVNQ
RTALPLHLLQHQALAVAGLSPLLRRSHSPTMFARLCSTPPATPCTQGRSRQQQHHYQRVP
TLRLEGVESCEKLNSSLPSVNCSSWYPEGGSSRKARPVSLTVPSHFSDVARQCHGSASSL
VEAVLISEGLGQFAQDPKFIEATTQELADACDMTIEEIENAADNILNGNTKPSPNGNLLP
FVNCRDLGPQDPGRDNPS
NT seq 6537 nt   +upstreamnt  +downstreamnt
atgacagcgtcagcaatcacgcatcatgaaggctccaactatccaagccctcattcctcc
ccgcactccaacctgaatgccaccaccacagccggcctggcccccgagcacatcccctcc
tcgggggcagcgctgtcctggcaagccgccatcgacgccgcccggcaggccaagctgatg
gggaacgcgggcaacgccaccatctccaccgtcagctccacccaacgcaagcggcaacag
tacagcaaacagaagaagcagggcaccaccggtgccaaccggccgccccgggcactgctg
tgcctcaccctgaagaacccaatccggagagcgtgcatcagtatcgtggagtggaaacct
ttcgaaatcatcatcttgcttacgatttttgccaactgcgtggcgttagccgtctacatt
cctttcccggaggatgactccaatgccaccaactccaatctggaacgagtggagtatctc
tttctcatcatctttacagtggaggcgtttctaaaagtcataggttacggcctccttttt
caccccaacgcctacctccgaaacggctggaatttactagatttcatcatcgtggttgta
ggactttttagtgctattttagaacaagctaccaaagcagaaggggtgaacccaataggg
ggaaaagctgctggttttgatgtgaaagctcttcgcgcctttagagtcctgcggccacta
cgcttggtgtcaggagtccccagtcttcaggtcgttttaaattccatcattaaggccatg
gtccctctactgcacattgccctgctggtcctgtttgtcatcatcatctacgccatcata
ggtcttgaactcttcatgggcaaaatgcataaaacctgctacttcacaagagacagcttt
ccaggtatcatggcagaagaagaaccagctccctgtgctttggactcaagtcatggacgg
cagtgccgaaatgggaccgtgtgcaagccaggttgggtgggacctaatgatggcatcacc
aattttgacaattttgcctttgctatgctaacggtattccagtgcataaccatggaaggt
tggacagacgtcctctactgggttaatgatgccattggaagtgggtggccttggatctat
tttgttacacttatcatcatagggtcattttttgtacttaacttggtgcttggtgtgctt
agcggagagttttccaaggaaagggagaaagccaaagctcggggggacttccagaagcta
cgagagaagcaacagctggaggaggacctgaagggctacctagactggatcactcaggca
gaagacattgatccggagaatgaggatgaagggctggatgaggagaaacccagaaacatg
agcatgccagccagtgaaacggaatccgtgaatatagataatgtgggtgcaaacgatttg
gagggggagaattgctgcactcagcttgtgcacagaatcaccaaatccaagtttagccga
tactggcggcgatggaaccgcttctgccggaggaagtgccgggctgctgtgaagtcaaat
gttttctattggttggtaatattcctggtcttcctcaacactttgacaatctcctcggag
cactacagccaacccaactggctgacacaagttcaggacactgcaaacaaggtgctgctg
gccttgttcacagcggaaatgctgctcaagatgtacagtctgggcttgcaggcctacttt
gtgtctctcttcaaccgcttcgactgcttcattgtttgcggaggaattctggagaccatc
ctggtggagaccaagatcatgtccccacttgggatctctgtcctgcgctgtgtccgcctc
ctgaggatatttaagattaccaggtactggaactccttaagtaacctggtggcatctctg
ctgaactcagtacggtctattgcttccctgctcctgcttctcttcctcttcatcatcatc
ttctccctgctgggaatgcagctgttcggaggcaagttcaactttgacgaaatggtgacc
cgaaggagcaccttcaataacttccctcaggccctcctcactgtctttcagatcctgaca
ggtgaggactggaattctgtgatgtatgatgggatcatggcctatggaggaccctccttt
cctggaatgctggtttgcatttacttcatcatcctctttatctgcggaaactatattctg
ctgaatgtcttcttggccatcgctgtggacaacctggccgatgccgagagtttgacttca
gctcagaaggaagaggaagaggagaaggagcgtaaaaaaatggccaggaactgtagcccc
gaaaagaaggtggagaatgagaaaccgatggaagacgaagaaaagaaagaggagaaaatc
gaattgaagtccatcacagtggatggagatgcccaacctacaaccaagattgcagtagag
gattaccagctggatggaaacgaggaaaaaagcagttaccccgtcaacgattttccaggt
gaagaggaggaggaggagcctgagatgcccgtcggtccccggccccgaccgctgtcagag
cttcaactgaaggagaaggctgtccccatgcccgaagccagcgccttctttgtgttcagc
tcttcaaacaggttccgcatcttttgccacaggattgtaaacgacaacatcttcaccaac
ttgatcctcttcttcatcctcttgagtagcatctccctggcagctgaggatcccgtccgg
cacacctcctccaggaaccagatactgttttattttgatatagttttcactatcattttc
accattgaaataaccctgaagatcctaggctatgcagactatgtcttcactagtatcttt
acactagaaattactctcaagatgacagcctacggagctttccttcacaaaggctccttc
tgtagaaattacttcaacatcctggaccttgtggttgtcagcgtgtcgctcatctctttt
ggaattcagtccagcgccatcaatgtggtgaaaatcctccgtgttctccgagtgctgaga
cctttaagagccatcaatagagccaaaggcctgaagcacgtggtacaatgtgtgtttgtg
gctatcagaaccatcggaaacattgtcatcgtcacaaccttactgcagtttatgtttgcc
tgcattggggttcaactctttaaggggaaattctacaggtgttcagatggctccaagcaa
acagaagcagagtgcagaggtcagtttattgtctacaaagacggtgatgttgcccatccc
cagctcgagaaacgagaatggaacaacagcaacttccactttgatgacatccttcacgcc
atgatggctctcttcactgtctccaccttcgaagggtggcccacactgctgtaccaggcc
atcgactctcacacagaggatgtgggtcccatctacaaccaccgggtggagatctccatt
ttcttcatcatctacatcatcatcatcgcctttttcatgatgaacatctttgtgggtttt
gttatcgtcaccttccaagagcagggagagcaggagtacaagaactgtgagctggacaag
aaccagcgccagtgtgtggagtatgccctgaaggcccgcccccaacgacggtacatcccc
aaaaacccataccagtacaaggtgtggtatgtggtgaactcctcctactttgagtacctt
atgttcgtcctcatcctcctcaacaccatctgtctggccatgcagcaccacggacgatct
tcctctttcaacgatgccatggacgtcctcaacatggtgttcacagggctcttcactgtg
gagatggtgctgaagctcattgccttcaaaccaagaggttactttagcgatccctggaat
gtctttgacttcctcatcgtaattggcagtattatagacgtcattctgagtgaaattaac
cactatttttgtgatgcatggaacacttttgacgccctcattgtggtgggtagcattgtt
gatatagccatcaccgaagtgaacccaactgaacatgccacctcaagtcccaacgccatg
gactccgaggacaactccaggatctccatcactttcttccgactcttccgcgtgatgcgc
ctggtgaagctgttgagccggggagaggggatccggacgctcctatggaccttcatcaag
tcattccaggcactgccttatgtcgctcttttgatagtgatgcttttcttcatctatgct
gtcatcgggatgcagatgtttggtaaaatcgctctggatgatgaaagtcagatcaataga
aacaacaattttcagaccttccctcaggctgttctgcttctcttcaggtgtgccaccggg
gaggcctggcaggagattatgttggcctgtatgccaaagagacgctgcgacccggagtcc
gagtcccccaactcatctagtgacgaggacacctcctgtggcagtagctttgccattttc
tacttcgttagcttttacatgctttgtgccttcttgatcattaacctgtttgtggctgtc
attatggacaactttgactacttgacacgtgactggtccattctgggaccccatcacctg
gacgaatttaaacggatctgggctgagtatgacccagaagcaaacactgtcacatcacgt
agctttttgacccagagcgcagggttttctcaggccaggtttgtagccatggacaagtgc
ttcaccttgttagagcccgtcagtacagtacagcaacctgagctgatggaggtgaagctg
agtcgtctggtgtccatgaacatgcctctgaacagcgacggcacagtgatgttcaacgcc
actctcttcgctttggttcgaactgcgctccgcatcaaaacagaagggaacctggaacag
gcgaatgaggagctgcgagccatcattaagaagatctggaagcggaccagcatgaagcta
ctggatcaggttgtgcccccagctggtgatgatgaagtaacagtgggcaagttttacgcc
accttcctcatccaggaatatttccggaaattcaagaagcgtaaagagcaaggtttggtg
ggaaaagtcccgcagaagaacgctctttctttgcaggccggtctgcggacgttgcatgat
atcgggcctgagatccggcgtgcaatatccggagacctgaccgcagaagaagagctggac
aaagcaatgaaggagaatgcatcagcagcttctgaggacgacatctttaggagagctggt
ggtctgtttggcaaccatgtcaactattatcaaagtgatggacggggctcattcccccaa
accttcacaacccagcggcctttacacatcaacaagaccgggaccgtgccaggggacgtg
gagtcaccgtcccacgaaaaattggtggactccaccttcacacccagcagctactcctcc
tcgggatcgaatgctaacattaataatgccaacaacacagcactgtgccacttccccagt
cctgccaacttccaaagtaccgtcagcacggtggaagggcacactggcaccctgccagct
accctgttacagcatggctcatcttggaaactcaatgctaaaagatcaaactctggggac
agccgactcccaatcatttgtcgagaggaaacctcccccgaagaaacctatgatgagaat
ttcaaccagaacacggaatacagcagcgaccagagcatattctcctcagaaatactttcc
taccaggacaacgaacacaagcagctgacaccttcagaagactgtgaggcggaagaggag
gagaaggccaggcagtcgccaaagcgaggcttcctctgtgcagcatcactagggaggaga
tcctcattccacctggagtgtttaaagaggcagaggacgcaaggaatggatgtcaatcag
aggacagcattaccactgcatctactccaacaccaggctttggcggtagccggcttgagt
ccgctgctcaggcgcagtcactctccaaccatgtttgccaggctgtgctccacgccgccc
gctacgccctgcacccagggaaggtcacggcagcaacagcaccactaccaacgtgtaccc
accctgcggcttgagggggtggagtcctgtgaaaagttgaacagcagcctgccctccgtc
aactgcagctcctggtatcccgaaggtggcagcagcaggaaagccaggcctgtgtccctc
actgtccccagccacttctcagatgtggcgagacagtgccacgggagcgccagcagcctg
gtcgaagcagttctaatctcagaggggctgggccagtttgcacaggacccaaagttcata
gaggccacaacacaggaacttgcggacgcctgcgacatgacaatagaagagatagaaaac
gctgccgacaacatcttgaatggcaacaccaagccgagcccgaatggcaacctcttgccc
tttgtgaactgcagggaccttgggccccaggacccaggacgggacaatccctcatag

DBGET integrated database retrieval system