KEGG   Latimeria chalumnae (coelacanth): 102358055
Entry
102358055         CDS       T02913                                 

Gene name
AIFM2
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2
  KO
K22745  apoptosis-inducing factor 2
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102358055 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA DAO Trp_halogenase AlaDh_PNT_C K_oxygenase FAD_binding_2 NAD_binding_8 HI0933_like FAD_oxidored Lycopene_cycl FAD_binding_3 ATP-synt AA_kinase DUF4147 Methyltransf_2 Amino_oxidase
Other DBs
NCBI-GeneID: 102358055
NCBI-ProteinID: XP_005996177
Ensembl: ENSLACG00000014806
LinkDB
Position
Un
AA seq 396 aa
MGSKLSIDENVHVVVVGGGFGGIAAAIQLKSLGVPYTLIDMKDAFHHNVGALRASVQSGF
AKTTFISYSATFNGNFKQGKVMDIDTQKQCVILEDREEVCFSHLILATGSDGPFPGKFNK
SVTKESAIQMYENLVQEVQKAERIVVVGGGSAGVEMAAEIKSDYPQKERHDVIVKRIGGG
PRQRRQADMEEVTLIHSKVALADVELLPSVRQTVKEILLRKGVKLLLSQRASNLTQLKLN
EVQQEMSVETDKGTTVTADLVICCTGIKVNSSAYSNALKLKLADNGALRVNEHLQVEGSE
NIYAIGDCADVKEPKMAYHAELHAKVAVKNIVNSLTQKPLAAYEPGRLTMLLSMGRNDGV
GQISNCYVGRILVVMAKSRGLLVWKSWWAMGQCVPS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggggtccaaattgtccattgatgaaaatgtccatgttgtggtggttggaggtggcttt
ggagggatagcagctgctattcaactaaaatctctaggagttccctacacactgattgac
atgaaagatgccttccatcataatgttggtgctctcagagcttctgtccaaagtggtttt
gctaagacgacttttatatcctatagtgccacctttaatggcaacttcaaacaaggcaaa
gtgatggacattgatacacaaaaacagtgtgtgattttagaggacagagaggaggtctgc
ttttcgcatctcatccttgcaactggcagcgatggccctttccctgggaaattcaacaag
tctgttacaaaggaatctgccattcagatgtatgagaacctggtacaagaggttcagaaa
gctgagaggattgtggtagtaggaggcggctctgctggggtggaaatggcagctgaaatt
aaaagtgattatcctcagaaagagcgtcatgacgtgatcgtgaaacgcattggaggcggg
ccgaggcagaggaggcaggctgacatggaagaggtaactctaattcactcaaaggtggcc
ctggcagatgtagagctgctacccagtgtccgacaaacagtgaaggagatcctcctgaga
aagggtgtaaagcttttattaagtcagagagcgagtaatcttacccagctaaagttaaat
gaagtccagcaggagatgagtgtggaaaccgacaaagggacgactgtgactgcggatctg
gttatctgctgtacggggattaaagttaactcttcagcatacagcaatgcactcaaattg
aagcttgctgataatggtgccttaagggttaacgaacacctccaagtggaaggaagtgaa
aatatctatgccatcggggactgcgctgatgtgaaggagccaaaaatggcatatcatgct
gagttgcatgccaaggtggctgtaaaaaacattgtcaacagtctgactcagaaacctctc
gcagcatatgaaccaggacgactcaccatgctgctgtcaatgggccggaatgacggggta
ggacagataagcaactgctacgtgggacggattttggtagtaatggctaagagtagaggc
ttgttggtctggaaaagctggtgggcaatgggccagtgtgttccatcttaa

DBGET integrated database retrieval system