KEGG   Latimeria chalumnae (coelacanth): 102358181
Entry
102358181         CDS       T02913                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04137  Mitophagy - animal
lcm04140  Autophagy - animal
lcm04210  Apoptosis
lcm04621  NOD-like receptor signaling pathway
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102358181 (BCL2L1)
   04137 Mitophagy - animal
    102358181 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    102358181 (BCL2L1)
   04115 p53 signaling pathway
    102358181 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102358181 (BCL2L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102358181 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcm01009]
    102358181 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcm03036]
    102358181 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcm02000]
    102358181 (BCL2L1)
Protein phosphatases and associated proteins [BR:lcm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102358181 (BCL2L1)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102358181 (BCL2L1)
Transporters [BR:lcm02000]
 Other transporters
  Pores ion channels [TC:1]
   102358181 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102358181
NCBI-ProteinID: XP_006008757
LinkDB
Position
Un
AA seq 222 aa
MSFNRLLVVDHISQKLMQRGYQWREVGEQDHGGGGDRAREAQTPEEGAIPGMDPPNGSHP
HAGLNGAVNGLPAGSSSRLEAQAVSGPEAVKRTLREAGEEFELRYSRAFSDLSSQLHITP
GTAYQSFEQVVNELFRDGVNWGRVVAFFAFGGALCVESMDKEMSSLVERIAEWMTTYLDD
NLNPWIQEQGGWVRQHVSLYFCLWLPRQPFGSLGLLGIFQVL
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtccttcaacaggttgctggtggtggaccatatatcccagaagctgatgcagcgggga
taccagtggagggaggttggtgagcaggaccacggtggtggaggagaccgcgcgagggaa
gcacagactcccgaggagggggccattccaggcatggacccacccaacggcagccaccct
catgcaggactcaatggtgcggttaacgggttgccggctggcagcagcagccgcctggaa
gcccaggcggtgtcggggcccgaagccgtgaaacggacattgcgagaggccggggaagag
tttgagctgaggtatagccgagcattcagtgacctctcttcccagctccacatcaccccc
ggcacagcctaccagagctttgaacaggtggtgaacgaactcttccgggacggagtgaac
tgggggcgcgtggtggctttctttgcctttggaggggcgttgtgtgtggagagtatggac
aaggagatgtcttcactagtagagcggatcgctgagtggatgacgacttacctagatgat
aacttaaacccttggattcaggaacaaggaggatgggtaaggcaacatgtgtctctgtat
ttctgtttatggttgcctaggcaaccgtttggtagcctagggttattgggtatttttcaa
gttctctaa

DBGET integrated database retrieval system