KEGG   Latimeria chalumnae (coelacanth): 102358325Help
Entry
102358325         CDS       T02913                                 

Gene name
RCC2, SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00020  Citrate cycle (TCA cycle)
lcm00190  Oxidative phosphorylation
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
Module
lcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lcm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102358325 (RCC2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102358325 (RCC2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102358325 (RCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 102358325
NCBI-ProteinID: XP_005996363
Ensembl: ENSLACG00000016108 ENSLACG00000016172
UniProt: H3B8R6
LinkDB All DBs
Position
Un
AA seq 285 aa AA seqDB search
MAVASVSLRRGCSLLNLRTVSLQWSHGSKAAAAAAPVSQVNSQTKKFAVYRWDPDKPGDK
PHMQTYEVDLDACGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTT
KIDTNLSKVTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESRQGKEQYLQSVE
DRDKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLSKLQ
DPFSLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKVAAA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgcgagcgtctccttgagacgaggttgttctttattaaacctaaggacagtt
tctttgcaatggtctcatgggagcaaggcagcggcagcagctgcacctgtttcacaggta
aattcacaaactaagaagtttgcagtatacagatgggatccagacaagcctggtgacaaa
cctcacatgcagacgtatgaggtggatcttgatgcatgtggacctatggtgctggatgct
ttgattaagattaaaaatgagatcgactccactttgacatttcgtagatcatgcagagag
ggtatttgtgggtcctgtgcaatgaacatcaatggtggtaacacactggcctgcacgacc
aaaatagacacaaacctcagcaaagttactaagatctacccgctcccacacatgtacgta
gtaaaggaccttgttccggatatgagtaacttctatgcccagtacaagtcaattgagcct
tacttgaagaaaaaggatgagtccagacagggtaaagaacagtacctccagtctgtggaa
gaccgtgataaactggatggactgtacgagtgtattctctgtgcctgttgcagtacaagc
tgtcccagctattggtggaatggagacaaatacctggggcctgctgtcctcatgcaggcc
tatcgctggatgatagactcccgcgacgacttcacagaggagcgcctgtcaaagctgcag
gaccccttctcgttgtaccgctgtcacaccattatgaattgcacaaagacctgtcccaag
ggactgaacccaggaaaagcaattgctgagatcaagaagatgatggcaacctataaagaa
aaggtagcagctgcataa

DBGET integrated database retrieval system