KEGG   Latimeria chalumnae (coelacanth): 102358360
Entry
102358360         CDS       T02913                                 

Gene name
SIVA1
Definition
(RefSeq) SIVA1 apoptosis inducing factor
  KO
K22744  apoptosis regulatory protein Siva
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102358360 (SIVA1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 102358360
NCBI-ProteinID: XP_005986421
LinkDB
Position
Un
AA seq 198 aa
MPKRPSPSGDIAPVQLKIHVGQKELSQGVCGHKYKKEIYEKTRKLLFSGAQTFMWNSKPE
GNCALNQGQEEICGAFSLMQGQALIGLDGKLSKNSLASQKAVGMSKACSVCRRLASIREA
CRLCDQFLCCSCSGCCSSCRRVCCSLCSVTELPILETELTYPWNRYSIGSHTANFPTDVL
QPCPRRTTKGRGCSSLVI
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcccaagagaccgagcccttccggggacattgctccggtgcaactaaaaatccacgtc
ggacagaaagagctgagccagggcgtctgcggacacaagtataagaaggagatatacgag
aaaaccagaaagctgctgttcagtggtgcacaaacctttatgtggaacagcaaacctgaa
ggaaattgtgcactaaaccagggacaagaagaaatctgtggtgcatttagtttgatgcaa
gggcaggccttaattggtctggatggaaaactgtctaaaaattctcttgcttctcaaaaa
gcagtggggatgtccaaagcctgctctgtctgcagaagattggcaagcattagagaagcc
tgcagactgtgtgaccagttcctatgctgcagctgtagcgggtgctgcagcagctgtaga
agagtgtgctgttcgctgtgctctgttacggaattgccaatactagaaactgaacttact
tatccatggaacagatacagcataggcagccatactgcaaacttccctactgatgtgctt
caaccctgccctagaaggaccaccaagggaagaggatgttcaagtctagtcatttaa

KEGG   Latimeria chalumnae (coelacanth): 102362452
Entry
102362452         CDS       T02913                                 

Definition
(RefSeq) apoptosis regulatory protein Siva-like
  KO
K22744  apoptosis regulatory protein Siva
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102362452
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 102362452
NCBI-ProteinID: XP_005988869
Ensembl: ENSLACG00000006952
UniProt: H3ADY0
LinkDB
Position
Un
AA seq 174 aa
MPKRKSPWGESCPLQLKSHISQKEVNEGVGREANMQAVYERTMSLLFLGSRSVKLNGLPQ
LSSNGCPHPCKTDKEELGDFSNDWGQLRLGLHGELVRSPFKAPVKGAAKPVCLTCAFCGK
PSCVDVVCWRCERVACANCQRCCSICGNIFCFLCCTVNYDSADEMVICSECSPR
NT seq 525 nt   +upstreamnt  +downstreamnt
atgcccaaaaggaagagtccctggggggagagctgccccctgcagctgaaatctcacatt
tcccagaaggaggtgaatgaaggggtgggcagggaagctaatatgcaggctgtgtatgag
cgtacgatgtctctcttgtttttggggtcccgctccgtgaagctgaacgggttgccccag
ttgagcagtaatggttgtccacatccctgtaagacagacaaagaggaattgggagacttc
agtaatgactggggtcagcttcgactcggactccatggggagctggtgaggagccccttc
aaagcacccgtgaaaggcgctgcaaagcccgtgtgtctcacgtgtgcattctgtgggaag
ccgtcctgtgtggatgtggtgtgttggcgctgtgaacgggtggcctgtgccaactgtcag
cgttgctgcagcatctgcgggaatatcttctgcttcctgtgttgtactgtcaactatgac
agcgcagacgagatggtgatttgtagcgagtgctcaccacgttag

DBGET integrated database retrieval system