KEGG   Latimeria chalumnae (coelacanth): 102359855Help
Entry
102359855         CDS       T02913                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04020  Calcium signaling pathway
lcm04114  Oocyte meiosis
lcm04140  Autophagy - animal
lcm04261  Adrenergic signaling in cardiomyocytes
lcm04270  Vascular smooth muscle contraction
lcm04310  Wnt signaling pathway
lcm04340  Hedgehog signaling pathway
lcm04371  Apelin signaling pathway
lcm04530  Tight junction
lcm04540  Gap junction
lcm04910  Insulin signaling pathway
lcm04912  GnRH signaling pathway
lcm04914  Progesterone-mediated oocyte maturation
lcm04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102359855 (PRKACB)
   04310 Wnt signaling pathway
    102359855 (PRKACB)
   04340 Hedgehog signaling pathway
    102359855 (PRKACB)
   04371 Apelin signaling pathway
    102359855 (PRKACB)
   04020 Calcium signaling pathway
    102359855 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102359855 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102359855 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102359855 (PRKACB)
   04540 Gap junction
    102359855 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102359855 (PRKACB)
   04912 GnRH signaling pathway
    102359855 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    102359855 (PRKACB)
   04916 Melanogenesis
    102359855 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102359855 (PRKACB)
   04270 Vascular smooth muscle contraction
    102359855 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102359855 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lcm03019]
    102359855 (PRKACB)
   03036 Chromosome and associated proteins [BR:lcm03036]
    102359855 (PRKACB)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102359855 (PRKACB)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: AGC group
  PKA family
   102359855 (PRKACB)
Messenger RNA biogenesis [BR:lcm03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102359855 (PRKACB)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102359855 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Pkinase_C
Motif
Other DBs
NCBI-GeneID: 102359855
NCBI-ProteinID: XP_005993903
Ensembl: ENSLACG00000012597
LinkDB All DBs
Position
Un
AA seq 398 aa AA seqDB search
MACQKELHCTQCSGTTSALQKLEGFANRLFHRHSKGTGHEQRICLESEGPVISEYTLLWD
KLMKEFLAKAKEDFLRKWECPPQSTACLDDFERQKTLGTGSFGRVMLVKHKTTEVYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRSPGDTSNFDDYEEEDIRVSITEKCAKEFAEF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatgccagaaagaactgcactgtacccagtgctcaggtacaacttcagctttgcaa
aaactggaaggatttgccaatcgtttgtttcacagacactcaaagggtactggtcacgag
cagaggatatgccttgaaagtgagggtccagtaatttcagagtacactcttctttgggac
aaattgatgaaagagttcttagccaaagccaaagaagatttcttacgaaaatgggagtgt
ccaccacagagcactgcctgcctagatgattttgagcggcaaaaaacccttggaacaggt
tcttttgggagggtcatgctggtgaaacataaaaccacagaagtatactacgccatgaag
atactggataagcagaaggttgtcaaactgaagcagatagagcacacgttgaacgaaaag
agaatattacaagcagtgaactttccatttctagtaagattggagtatgcatttaaggac
aactcaaatttatatatggtgatggaatatgttcctggtggtgaaatgttctcacatctt
agaagaattggaaggttcagcgaaccccatgcacggttctatgcagctcagatagtactt
acatttgagtacctccattcgttagacctcatctacagagacctgaagcctgaaaacctt
ttaattgatcaacaagggtacatccaggtcacagactttggttttgccaaaagggtaaaa
ggaagaacttggacattgtgtggaactccagaatacttggctccagagattatactcagt
aagggttataacaaagcagtggattggtgggcattaggtgttctaatctatgaaatggca
gctggctaccccccattctttgcagatcagcctattcagatttatgaaaaaattgtctcc
ggaaaggtacggtttccttctcacttcagttcagacttaaaggacttgctgaggaatttg
ctccaagtggacttgacaaaacgatatggaaacctcaagaatggtgtgaatgacattaag
aaccacaagtggtttgctactacagactggattgccatctatcagagaaaggttgaagct
ccattcataccaaagtgtagaagccctggagacaccagcaactttgatgactatgaagag
gaagatatccgtgtttcgattacagaaaaatgtgcgaaagagtttgcagaattttag

DBGET integrated database retrieval system