KEGG   Latimeria chalumnae (coelacanth): 102359961Help
Entry
102359961         CDS       T02913                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00500  Starch and sucrose metabolism
lcm01100  Metabolic pathways
lcm04910  Insulin signaling pathway
Module
lcm_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102359961 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102359961 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcm01003]
    102359961 (GYS2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102359961 (GYS2)
Glycosyltransferases [BR:lcm01003]
 Polysaccharide
  Storage polysaccharide
   102359961 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 102359961
NCBI-ProteinID: XP_005998919
Ensembl: ENSLACG00000009666
UniProt: M3XIT6
LinkDB All DBs
Position
Un
AA seq 705 aa AA seqDB search
MPLARSLSMTSLNELPQWEDEDLPVEDLLLFEVSWEVTNKVGGICTVIQTKAKITVDEWG
ENYVMIGPYFEHNVKTQVEMFTPQNPAIKKAMDILILNGCQVYFGRWLIEGNPYVLLFDI
HSAAWKLDKWKGEFWNACGVGLPSGDRETNDALIFGSLTAWFLKELTDELQGKKNIIVNF
HEWLAGTGLILSRFKKLPIATIFTTHATLLGRYLCAANIDFYNNLDKFNVDKEAGERQIY
HRYCIERASVHCAHVFTTVSQITAIEAEHMLKRKADVVTPNGLNVKKFSAMHEFQNLHSM
YKARIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGVDIFLEALSRLNFLLQVHKND
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHTVKEKFGKKLYEALLKGEIPDMSKI
LDRDDLTIMKRAIYATQRQTLPPVTTHNMSDDSTDPILSNIRRIGLFNNRTDRIKVVLHP
EFLSSTSPLLPLDYEEFIRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
DHVADPDAYGIYIVDRRFRSLDESCNQLTQFMYRFCQQTRRQRIIQRNRTERLSELLDWR
YLGRYYMHARHLGLSRAFPNKFKMEPIAPPRTEGFRYPRPPSVPPSPSVSLHSSPHHSEG
EDEDDDDERYDEDEEAEKDRKNIKSPFAPELVLEGERKQHGEYKN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgccactagcaagatcactttcgatgacctccttaaatgaactccctcaatgggaggat
gaagatttacctgtagaagacttgttgctctttgaagtgtcttgggaagttacaaataaa
gttggtggcatctgtactgtaatccagacaaaggccaaaatcacagtggatgaatgggga
gaaaactatgttatgattggtccatattttgagcataatgtgaagacgcaggtagaaatg
tttacacctcaaaacccagcaattaaaaaagccatggacattttgatattaaatggctgt
caggtatattttggaagatggctgatagaaggcaacccatatgtattgctgtttgacata
cattcagcagcttggaagttagacaagtggaaaggggaattctggaatgcatgtggagtt
ggattaccttctggtgacagagaaactaatgatgctttaatttttggatccctgaccgcg
tggtttttaaaagagcttactgatgaacttcaagggaaaaaaaacatcattgttaatttt
catgaatggctcgcaggaactgggctaatactttcaaggtttaagaaactccccatagca
acaatctttaccactcatgctactctactggggagatacttatgtgctgccaacatagat
ttctataacaaccttgacaagtttaatgtagataaagaagcaggtgaaaggcagatttac
catcggtattgcattgagcgtgccagtgtccactgtgcacacgtctttacaacagtttct
cagatcacagccattgaggccgagcacatgttgaagagaaaagctgacgtggttactcct
aatggtttgaatgtgaagaaattttcagctatgcatgaatttcagaatctgcactccatg
tacaaggctcgtatccaagagtttgttcgaggacatttctatgggcatcttgactttaat
ctggaaaagacccttttcttcttcattgctggaagatatgaattttcaaacaaaggggta
gatatatttttggaagccttgtccagactgaacttcctcctgcaggttcacaagaatgat
gttacagtcatagtctttttcataatgcctgcaaaaacaaacaacttcaatgtggaaacc
ctaaaggggcaggcagtcagaaagcagttatgggatactgctcatactgttaaagaaaag
tttggaaagaagctctatgaagcattgttaaagggagaaattcctgatatgagcaagatc
ctcgatcgtgatgacctaacaatcatgaaaagagccatctatgcaactcagcggcaaaca
ctacctccagtaacaactcacaatatgagtgatgattccactgacccaatcctcagcaat
atcagaagaatcgggctattcaacaatcgcactgatagaatcaaggttgtcctacaccca
gagtttctttcttctacaagtccactattacccttggattatgaagagtttatcagagga
tgccatcttggggtctttccatcatactatgaaccctggggatatactcccgctgaatgt
acagtgatggggattcccagtgtaacaaccaacctttctggatttggctgcttcatgcaa
gatcatgtagctgatccagatgcctatggtatttacattgttgaccgccggtttcgttct
ctagatgagtcctgtaatcagctgacccagttcatgtatagattttgccagcagacacgt
cgtcagagaatcattcaaagaaatcgcactgagaggctttcagagctactggactggaga
tatctaggcagatactacatgcacgctagacatctaggactgagcagagcctttccaaac
aagttcaagatggaaccaatagctccaccaaggacggaaggtttccggtaccccagacct
ccttctgttccaccatctccttctgtgtctttgcattcaagtcctcaccacagtgaagga
gaagatgaggatgatgatgatgaaaggtatgatgaagatgaagaagctgaaaaagacagg
aagaacattaagtcaccatttgcacctgaattagtactggaaggggaaaggaaacagcat
ggggaatacaaaaattga

DBGET integrated database retrieval system