KEGG   Latimeria chalumnae (coelacanth): 102360184
Entry
102360184         CDS       T02913                                 

Gene name
SERPINE1
Definition
(RefSeq) serpin family E member 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102360184 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102360184 (SERPINE1)
   04218 Cellular senescence
    102360184 (SERPINE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcm01002]
    102360184 (SERPINE1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102360184 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:lcm00536]
    102360184 (SERPINE1)
Peptidases and inhibitors [BR:lcm01002]
 Peptidase inhibitors
  Family I4: serpin family
   102360184 (SERPINE1)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102360184 (SERPINE1)
Glycosaminoglycan binding proteins [BR:lcm00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   102360184 (SERPINE1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 102360184
NCBI-ProteinID: XP_006009596
Ensembl: ENSLACG00000005490
LinkDB
Position
Un
AA seq 401 aa
MKMQLPMASLLCLSLTIAVGTFDSAVASKVTELATDFGIRVFQEVVSSKGDQNVAFSPYG
VTSVLAMLQLGAAGTTEEQLRTAMKYGLNEKGVAIALRQLKKALVSPWNRDIVSTVDAVF
VQRDMELVNGFIKNFYRTFRDMPKQVDFSDQQRATYIINDWVKVHTEEMINDFLGPDTLD
EMTRLVLINAIYFKGLWKLPFPEEATHSRLFHKSDGSTVLVPMMAQTAKFNYSEFISPTG
VDYDVIELPYHGEALSMLIAAPFKKAVPLTSLTKDLDVKLISQWKENLRRASRTLILPKF
SLENEIDLKKPLSNMGMKDMFDQVKANFAKISRAENLFVSQALQKVKIEVDESGTKASAA
TAAIVYARMAPLEVVMDRPFLFVVRHNPTGAILFMGQVMEP
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaaaatgcagctgccaatggcttctctcctctgcctgtccctcaccattgctgtgggg
acctttgacagtgctgtggcttctaaagtgactgagctagccacagatttcgggatcaga
gttttccaggaagttgtgagttccaagggggatcagaacgtggcgttttccccatatggg
gtaacatcagtcttggcgatgttacagctgggagccgcaggtaccactgaggagcaactc
agaactgccatgaaatacggactgaatgagaaaggcgtggccatcgccctgcgacagctt
aagaaggcgcttgtgtcaccgtggaaccgtgatattgtgagcacagtggatgcagtattt
gtgcagagagacatggagctggtgaatggcttcataaagaacttctacaggaccttcagg
gacatgcccaaacaggtggacttcagtgaccagcagagagccacttatatcatcaacgac
tgggtgaaggttcacactgaagagatgatcaacgatttcctcggcccagacactctggac
gaaatgacccgtttggtgctgattaacgccatttacttcaaaggcctgtggaagctgcca
ttcccagaagaggccacccactcacggcttttccacaaatccgatgggagcacagtgctt
gtcccgatgatggcccagaccgcaaagtttaattacagcgaattcatctcccccaccgga
gtcgattacgatgtcattgagttaccctaccatggcgaggccttgagcatgctcattgct
gcaccttttaagaaggctgtccctttgacgtcgctgaccaaggatcttgacgtaaaactc
atcagtcaatggaaagaaaacctgaggagagcaagtcgcacccttattctgcccaagttt
tccctggaaaatgagattgacctgaagaagcccctgtctaatatgggaatgaaggacatg
ttcgaccaagttaaagccaactttgccaaaatctcacgggcagagaacctgtttgtgtct
caggctctacagaaagtaaaaattgaagtcgacgaaagtgggacaaaggcctctgcagca
acagcggcaatcgtctatgctaggatggctcccttggaagtggtgatggacaggccgttc
ctgtttgtcgtacggcacaatcccacaggggccattctcttcatgggtcaggtcatggag
ccttaa

DBGET integrated database retrieval system