KEGG   Latimeria chalumnae (coelacanth): 102360554Help
Entry
102360554         CDS       T02913                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102360554 (SUV39H2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102360554 (SUV39H2)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102360554 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102360554 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 102360554
NCBI-ProteinID: XP_006013568
Ensembl: ENSLACG00000002434
UniProt: H2ZZA1
LinkDB All DBs
Position
Un
AA seq 480 aa AA seqDB search
MTFGKSLAPRIVLFFWSKDSGSKITHLLTLFIPVFPKKSFLLCLRAVTSLLGAGKRFHPP
RANSTSAALNGGSKMAAKSGAWCVPCLASVEVLQELCRKEKLICKSIGITKRSLNDYEVE
YLCDCAIEKDTEYYLVKWKGWPESANSWEPKKNLRCRLLLKHFHNDQHEFLSRHKHSNAQ
TLKNSIQRLEPAIADYVVQKAKQRIALERWEEELNWKKNHRGKILVENTMDLEGPPLDFH
YINQYKASPGIYLSTEALVGCECSNCFLGKCCPLGAGVDFAYNEHGQLKIKPGQPIYECN
SQCKCSLECPNRVVQKGTPYSLCIFRTSNGRGWGVQTLQKIKKNSFVMEYVGEVITSEEA
ERRGQLYDSKGTTYLFDLDYESDEFTVDATRYGNISHFVNHSCDPNLQVFNVFIENLDLR
IPRIALFSTRNIKAREELTFDYQMKGSGDLSPESVDISPAKKRARTACRCGSVSCRGYLN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacattcggcaaatccttggctcctaggatagtcctttttttttggtccaaagactcc
gggagcaaaataacgcacttgctgacgctgtttattcctgtttttccaaaaaaatctttt
ctgctttgcctccgagctgtcacttccctgcttggcgcgggtaagcgcttccatcccccc
cgagcaaactcaacgtcagcggctttgaatggaggctccaagatggctgcaaagagtgga
gcctggtgtgtgccatgcctagcttcagttgaggtcctccaggaattgtgtagaaaggaa
aagctcatttgtaaatctattgggatcaccaaaagaagcctaaatgactatgaggtggaa
tatttatgtgactgtgcaatagaaaaggatacagaatattatctggtgaaatggaaggga
tggccagaatctgccaacagctgggaacccaagaaaaatctcaggtgccgtttgcttctc
aagcatttccataatgaccagcatgaattcttgtctcggcacaagcacagtaatgcacaa
actttaaaaaacagtatacagagactggaacctgccattgcagactatgtggtccagaaa
gctaaacagcgaattgcactggaaaggtgggaagaagagctcaattggaaaaagaaccac
agggggaagatcctggtggaaaacactatggaccttgaaggccctccattagactttcac
tacataaaccaatataaggcctcccctggtatatatttgtctactgaagcactggttggg
tgtgaatgttcaaactgcttcttgggcaagtgttgccctctaggggctggagtggatttt
gcttacaatgaacatggacagttaaaaattaaaccagggcagcccatctatgaatgcaac
tcccagtgtaagtgcagcttggaatgtccaaacagggtggtacaaaaaggtacaccctat
tcactttgcatctttaggactagcaatggccgaggttggggagtacagaccctgcagaaa
attaaaaagaatagttttgtgatggaatacgttggggaggtaatcacaagcgaggaggca
gagaggagaggtcagctgtatgacagtaaaggcaccacctacttgtttgatctagattat
gagtcagatgaattcactgtagatgctacacgatatggaaatatttcacactttgtaaac
cacagttgtgacccaaaccttcaggtattcaatgtcttcattgagaatcttgatcttcgg
atcccaagaattgcactattttcaacaagaaacatcaaggcgagagaagaacttactttt
gactatcagatgaaagggtctggagatctaagtccagaatctgttgacatcagtccagcc
aagaagagagctagaactgcttgcaggtgtggatctgtgtcctgtagaggatatctgaac
tga

DBGET integrated database retrieval system