KEGG   Latimeria chalumnae (coelacanth): 102360597
Entry
102360597         CDS       T02913                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102360597 (BID)
   04217 Necroptosis
    102360597 (BID)
   04115 p53 signaling pathway
    102360597 (BID)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102360597 (BID)
SSDB
Motif
Pfam: BID
Other DBs
NCBI-GeneID: 102360597
NCBI-ProteinID: XP_006008261
LinkDB
Position
Un
AA seq 177 aa
MSEEETESVLYNFLKQKQDCEKALLHLRLSSHRKDFEEEGELQTDGSISFRIGHTLEEAR
PEGLEYDHPIYTEIARRLAEIGDEIENKIQQNVAQQLALEMNRDKSQQAKDDSFLKAVKG
LCDQMSFDLEKEKLILVTSMVLVRKVALQCPTTLQPVFTGAVRIITHIVRQRGQGSV
NT seq 534 nt   +upstreamnt  +downstreamnt
atgagtgaagaggaaacagagtctgttttatacaacttcctaaagcaaaagcaggattgt
gagaaagcactgttgcacctgagactgagctcccacaggaaggactttgaggaagaaggg
gaactccaaactgatgggagtatttctttcagaattgggcacacccttgaagaggcaaga
ccggaaggtcttgaatatgaccatccgatttacacagagatagctcgtcgtttggccgag
ataggagacgagatagagaataaaatccagcagaatgtagcacagcagcttgctctcgag
atgaacagagacaaaagccagcaggcaaaagatgattcctttttaaaagctgttaagggc
ttgtgtgatcagatgagctttgacctggaaaaggaaaagttgattttagtaacatccatg
gttttagtaagaaaagtggccctgcagtgccccaccacgctgcagccagtcttcacggga
gctgtgcggattatcactcacatcgtaagacagagaggacagggaagtgtttga

DBGET integrated database retrieval system