KEGG   Latimeria chalumnae (coelacanth): 102360620Help
Entry
102360620         CDS       T02913                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00500  Starch and sucrose metabolism
lcm01100  Metabolic pathways
lcm04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102360620 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102360620 (GYS1)
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102360620 (GYS1)
Glycosyltransferases [BR:lcm01003]
 Polysaccharide
  Storage polysaccharide
   102360620 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 102360620
NCBI-ProteinID: XP_014341038
Ensembl: ENSLACG00000017841
LinkDB All DBs
Position
Un
AA seq 735 aa AA seqDB search
MPLVRSLSVTSLTGLEDWDNQFVQENVTLFEIAWEVANKVGGIYTVIQTKAKITADEWGE
NYILIGPYFEHNVRTQVELLDPPNLAIKRAIESMNSKGCKIYFGRWLIEGSPYVVLIDIA
ATAWSLDRWKTELFDSCAIGIPWYDREANDAVLFGFLTTWFLGEFVAQCEDKPYIVAHFH
EWLAGIGLVLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLPKFNLDKEAGDRQIYH
RYCMERAAVHCTHVFTTVSQITAVEAENMLKRKPDIVTPNGLNVKKFSAMHEFQNLHAKS
KARIQEFVRGHFYGHLDFNLDKTLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNQSEI
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAHAVKEKFGKKLYESLLVGQLPDMNKML
DKEDFTMMKRAIFGTQRQSLPPICTHNMLDDLTDPILNTMRKMGLFNASNDRIKVIFHPE
FLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSSYGIYILDRRYRNVDESCNQLTSFLYSFCQQTRRQRIIQRNRTERLSDLLDWKY
LGRYYMYARHMALAKAFPDNFTYEPHEATAAQGFRYPRPASVPPSPSISRHSSPHHSETD
EDDERYDEEEEAEKDRLNIKPPAMMVPASEWRMRSKKGSIDTGTTSTNSNASTPTNPSSP
SDLSSAGSSLVDERN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggtcaggagcctgtcagtcacttcactgactggcctggaggattgggacaat
cagtttgtccaggagaatgtaacactcttcgaaatcgcttgggaggttgccaacaaggtt
ggcggaatctacactgtaatacagaccaaagcaaaaatcacagcagatgaatggggggag
aactacattctgattggtccgtactttgagcacaatgtccggacacaggtagagcttctg
gatcctccgaatctggctatcaaacgggccatcgagtccatgaactccaaggggtgtaag
atatattttgggaggtggttgattgaaggcagtccctacgtggtgctcattgatatcgca
gccacggcctggtccctggatcgctggaaaacagaactctttgatagctgtgccattggc
atcccctggtatgaccgtgaggccaatgatgccgttctctttggcttcctgactacatgg
ttcctgggagagtttgttgctcagtgtgaggacaagccctacattgtggcccatttccac
gagtggttagcagggattgggctggttttgtgtcggatccgaaagctgcctgtggccacc
attttcaccacccacgccacccttctgggtcgctacctgtgtgctggcaatgtggacttc
tacaacaacttacccaaattcaatttggacaaggaagccggggatcggcagatctatcat
cgttactgtatggagcgtgctgccgtgcactgcacgcacgtcttcaccaccgtctcacag
atcactgcggtcgaggcggaaaacatgctgaaacgcaaacctgatattgtgactccaaat
ggtttgaatgtgaagaagttctcggctatgcacgagtttcagaatctccacgccaaaagc
aaagcaagaattcaagagtttgtccgagggcatttctatgggcacttggattttaacctg
gacaagacactcttcctcttcattgctggacgctacgaattttcgaacaaaggggcagac
atcttcctagaggcactggctcgtttgaactaccttctcagggtgaatcagagcgagatc
acggttatcgcctttttcatcatgcccgctcgcactaacaacttcaacgtggagacactc
aagggacaggccgtgaggaaacagctctgggatacagcacacgcagtcaaagagaagttt
ggcaagaaactttacgagtctctgctggtaggacaacttccagatatgaacaagatgctg
gacaaagaagacttcactatgatgaagagagctatttttgggactcagcgtcagtcgcta
cccccgatttgcacccacaacatgctggacgatctgacggaccctattctgaacaccatg
cgcaagatgggccttttcaatgccagcaatgaccgtatcaaggtaatcttccaccccgag
ttcctgtcttccaccagcccgctgctgcctctagactatgaagaatttgtccgtggctgt
catctgggtgtcttcccttcctactatgagccctggggttatacacctgctgaatgcact
gtgatgggaatccccagcgtctccaccaacctctcaggatttggctgcttcatggaggag
cacattgctgacccatcttcttacggaatctacatcctggaccggcgataccgcaatgtg
gatgaatcctgtaatcagctgacctccttcctctacagcttctgccagcagacacggcgc
caacgcatcatccagcgtaatcgcacagaacgcctctcagacctgctggattggaaatac
ctcggccggtattatatgtacgcccgccacatggcactggcgaaagccttccctgacaac
ttcacgtatgaacctcatgaagctacagctgcgcagggattccgataccctcggccggcc
tcggttccgccctcaccgtccatctcccgccactccagcccccaccacagtgagacagac
gaggatgatgaacgctatgacgaggaagaggaggctgagaaggaccgactcaacatcaag
ccacctgccatgatggtacccgcttctgagtggcgcatgcggtccaagaaggggtctatt
gacactggtaccaccagtaccaacagcaacgccagcaccccaaccaatcccagcagtccc
agtgacctcagcagcgctgggagctccttagtggatgagagaaactag

DBGET integrated database retrieval system