KEGG   Latimeria chalumnae (coelacanth): 102361010
Entry
102361010         CDS       T02913                                 

Gene name
RRM2
Definition
(RefSeq) ribonucleotide reductase regulatory subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00230  Purine metabolism
lcm00240  Pyrimidine metabolism
lcm00480  Glutathione metabolism
lcm00983  Drug metabolism - other enzymes
lcm01100  Metabolic pathways
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102361010 (RRM2)
   00240 Pyrimidine metabolism
    102361010 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102361010 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102361010 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102361010 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcm03400]
    102361010 (RRM2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     102361010 (RRM2)
DNA repair and recombination proteins [BR:lcm03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102361010 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 102361010
NCBI-ProteinID: XP_005998739
Ensembl: ENSLACG00000011284
UniProt: H3AT42
LinkDB
Position
Un
AA seq 389 aa
MLSSRSPLSTKNENVMVAKMNSVSLTESQKENTPPSLNSTRILASRTARKIFQDGETDSV
KSKVNDLQDEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDIQHWDSLK
AEEKYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI
DTYIKSPEEREYLFNAVETLPCVKKKADWALHWIGDCQSSYGERVVAFAAVEGIFFSGSF
ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEQKVREILIDAVKIE
QEFLTDALPVNLIGMNCTLMKQYIEFVADRLMLELGFGKIFRAENPFDFMENISLEGKTN
FFEKRVGEYQRMGVMAKATENTFTLDADF
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctgtcctctcgctctcctctttctacaaagaacgaaaatgtgatggtggcgaaaatg
aatagcgtttctctgactgaatctcaaaaagaaaacacgccgcccagtctgaacagcacc
agaatcctggcgagcagaaccgcccggaaaatcttccaggatggtgaaaccgattccgtt
aaatccaaagtaaatgatctgcaggatgagcccttgctaagagagaacccacgtcgattt
gtcatttttccaatccagtaccatgatatttggcagatgtacaaaaaggcagaagcttcc
ttctggacagctgaagaggttgatctctctaaagatattcagcactgggattctttgaaa
gcagaggagaaatactttatttcccatgttttggcgttctttgcagcaagcgatggcatt
gtaaatgaaaatttggtggagcgatttagccaagaagtgcaaataacagaagcacgctgt
ttctatggtttccaaattgccatggagaacattcattcagaaatgtacagtcttcttatt
gatacctacattaagagcccggaggagagggaatacctcttcaatgcagttgagactttg
ccctgtgttaagaagaaggctgactgggctctgcactggattggggattgccagtcctcc
tatggtgagcgtgttgtggcatttgcagctgtagaagggatctttttctctggttcattt
gcttctatattctggctgaagaaacgaggactgatgcctgggttgaccttttctaacgaa
cttattagccgagatgagggtttgcactgtgactttgcctgtctgatgttcaaacatttg
atcaataagccctctgaacagaaagtcagggagattctcatcgatgcggtcaagatagaa
caggagttcctgactgatgccttaccagtaaacttgattggaatgaactgcactttaatg
aaacagtacattgaatttgtagcggatagactgatgctggagctgggtttcggtaagatc
ttcagagcagagaatccatttgacttcatggagaatatttccctggaaggcaagaccaac
ttctttgagaagcgtgtaggggagtaccagagaatgggagtgatggctaaggcaactgag
aacactttcactctggatgctgatttctaa

DBGET integrated database retrieval system