KEGG   Latimeria chalumnae (coelacanth): 102361051
Entry
102361051         CDS       T02913                                 

Gene name
IGF1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04068  FoxO signaling pathway
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04150  mTOR signaling pathway
lcm04510  Focal adhesion
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102361051 (IGF1)
   04068 FoxO signaling pathway
    102361051 (IGF1)
   04150 mTOR signaling pathway
    102361051 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102361051 (IGF1)
   04115 p53 signaling pathway
    102361051 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102361051 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102361051 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcm04052]
    102361051 (IGF1)
Cytokines and growth factors [BR:lcm04052]
 Growth factors
  Growth factors (RTK binding)
   102361051 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 102361051
NCBI-ProteinID: XP_006010646
Ensembl: ENSLACG00000022367
LinkDB
Position
Un
AA seq 157 aa
MKKANNHSTQMFQCHFCDFLKMKKMCTRSYIHLFCLILCVLNLTHSTAAAGSETLCGAEL
VDTLQFVCGDRGFYFHKATGYGSSGRGRGQGHKGIVNECCFQSCDLRRLEMYCAPPKTSK
STRSVRAQRHTDMPKAQKPKQKRIRRLQTNPIQKHHT
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaaaaaagccaacaatcattcaacacaaatgtttcagtgccacttttgtgatttccta
aagatgaagaagatgtgcactagatcctatatacatttattctgcttgattctgtgtgtg
ctgaatctgactcattctactgcagctgctggttcagagactttgtgtggagctgagctt
gtggacactcttcagtttgtatgtggagacagaggattttatttccataaagcaacaggc
tatgggtcaagtggacgaggccgaggacaaggacacaagggaatagtgaatgaatgctgc
ttccagagttgtgacctgagaaggctagagatgtactgtgcccccccaaagacatccaag
tctacgcgctctgtacgtgctcaacgccacactgatatgccaaaagcacaaaagccaaaa
cagaaaagaataagaaggttgcaaaccaatccaatccagaaacaccatacttga

KEGG   Latimeria chalumnae (coelacanth): 102365620
Entry
102365620         CDS       T02913                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04068  FoxO signaling pathway
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04150  mTOR signaling pathway
lcm04510  Focal adhesion
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102365620
   04068 FoxO signaling pathway
    102365620
   04150 mTOR signaling pathway
    102365620
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102365620
   04115 p53 signaling pathway
    102365620
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102365620
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102365620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcm04052]
    102365620
Cytokines and growth factors [BR:lcm04052]
 Growth factors
  Growth factors (RTK binding)
   102365620
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 102365620
NCBI-ProteinID: XP_005987748
LinkDB
Position
Un
AA seq 203 aa
MSSAEQSNSLSEFGISSTRHCVLKAHSKRQFWLLCPILCFLTLAQRLVEAETLCGSELVD
TLQFVCGERGFYFSRRYSYKYSAKKSSRGIVELCCFRGCDLQLLESYCAKSHRSARSVME
LVSKKNPTHEEEHFKRGAKRDSLPPNLTSFEYKRRMNNANLKDSKPGVQTLWNYFSSRNR
SRVLLIRNSTMNIPVSRTAKEWK
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagttctgcagaacaatccaattctctgagtgagtttggaatatcatcaaccagacac
tgtgtgttaaaggcacattcaaaaagacagttctggcttttatgccctatcctctgcttc
cttaccttagcacagaggttggtggaagctgaaactctctgtggctcagagttagtggac
acccttcagtttgtgtgtggtgaacgtggcttttattttagtcggcgttattcatacaaa
tacagtgcaaaaaaatcaagcagaggcattgtagagctttgctgttttcggggatgtgac
ctgcagttactggagtcttactgtgccaaatctcaccggtctgccaggtctgtaatggaa
ctagtttccaagaaaaaccctacacatgaggaagaacattttaaaagaggtgccaagaga
gattctttgcctcctaatttgacctcatttgaatataaaagaagaatgaataatgcaaat
ttaaaagattcaaagccaggggttcaaacactatggaactatttttcatccagaaacaga
agtcgtgtgttactgatcagaaactcaaccatgaacattccagtgtcgagaacagctaag
gaatggaaatag

DBGET integrated database retrieval system