KEGG   Latimeria chalumnae (coelacanth): 102361138Help
Entry
102361138         CDS       T02913                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00052  Galactose metabolism
lcm00500  Starch and sucrose metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102361138 (GANC)
   00500 Starch and sucrose metabolism
    102361138 (GANC)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102361138 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 102361138
NCBI-ProteinID: XP_014353430
Ensembl: ENSLACG00000004050
LinkDB All DBs
Position
Un
AA seq 923 aa AA seqDB search
MESGAESTGEESVLPEAVDSSKFKTCNQIAFYRRQKLLHPGESTYRALLDTFTTSKHGAE
VQIINEENKVPLLVQIFGFEGSIIRVKINELKPLKPRYEVPDVLVKEPITQRMKMVRKEE
NGICLASDNGACEIHITVKPFQIDITSQGETVLSINSLGLLFFEHLRPQPASRGQFELSR
LSCTLPSKRMNQPQKACCSNQSLSPVSIHIISVVNGSFFFSLSLSPHSVFLQSVQDDLGL
WEEKFQTFVDVKANGPSSVGLDFRFHGYEHFYGIPEHADTLQLRTTSDDPYRLYNLDVFA
YQLWSRMGLYGSVPLLLAHKPVQTIGLFWFNASETLVDISTTAAVKYSQSILSPGQRKER
IVPQTDVRWMSESGIIDAFVLLGPSPLAVFKQYAQLTGIPALPPLFSLGYHQCRWNYEDE
ADVKQVDAGFDEHDIPYDVIWLDIEHTESKCYFTWDKQRFPNPKEMQTHLQEKKRKAVLC
PSSYLDFTHPEAREWYAGQFSFDKYQGSSEILFVWNDMNEPSVFLGPELTMQKDLVHRGG
WEHREVHNLYGFYQQMATADGLLLRSKGKERPFVLSRAFFAGSQRYGAVWTGDNVANWDY
LRISTPMLLTISLCGISFCGADVGGFYQDPDPELLVRWYQAGAYQPFFRGHACSGTKRRE
PWLLGEENMCVIREAIRERYELLPYWYTLFYRAHVFAEPVMRPIWVEFPDEITTFGIDHE
YFLGNALLVHPVTDAGVTTVDVFLPGSDEIWYNIRTFKRHEGAQTLCVPVSIESIPVFQR
GGSIVPRKTRVCRSTEWMKDIPYVLHVALDFKGSAVGELFLDDGHSFDYQAENKFIHKRF
SFNNNTLSSSSADRREHFQTSCEVEEVLIMGFEAAPSSVTVQNSGEKEAAVRFNYDAGTS
VLTLENLCVNVGTEWTIKIHRNK
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaggtgctgaaagcactggggaggagagtgtcctgcctgaagccgttgacagt
agcaagttcaaaacctgcaaccagattgctttctacagacgccagaaattgctgcatccc
ggagaatcaacatatcgtgcattattggatacatttactacatccaaacatggagctgaa
gttcagattattaatgaagaaaataaggtacctctccttgttcagatcttcggatttgag
ggcagcataatcagggtgaagatcaatgaactgaaaccactgaaaccccgatatgaagtt
ccagacgttcttgtcaaggagcctataactcagaggatgaagatggtgagaaaggaggag
aatggtatttgcttggcctctgataacggggcctgtgaaattcacatcaccgttaaacct
ttccagatagatataacgtcccaaggagagacagtgctgagcatcaattcccttggacta
ctgttcttcgaacatctacgaccccaacctgcaagcagaggacaatttgagctaagtcgt
ttgtcctgtacactaccctcgaaaaggatgaaccagccccaaaaggcttgctgttctaac
cagtctctcagtcctgtttcaattcatatcatttctgtggttaacgggtctttttttttc
tctctctctctctccccacactctgtttttcttcagagcgttcaagacgaccttgggctc
tgggaggaaaagtttcaaacatttgtagatgttaaagctaatggtcccagttctgttggc
ttggatttccggttccatggatatgaacatttttatggaataccggaacacgcagataca
ctgcagctccgaaccaccagtgatgatccgtatcggctctataatctggatgtttttgcc
taccaactctggagtcggatgggactctacggctccgtgccactcctgctagctcacaaa
ccagtgcaaaccattgggctcttctggttcaatgcctccgagactctggtggatatcagc
acaacggcagcagtgaagtattcccagtccatattgtctcctggacagagaaaggagagg
attgttccccaaacagatgtgcgctggatgtcagagagtggaattatcgatgcttttgtc
ctgctgggcccttcgcctttggctgtgttcaagcagtatgctcagctcacaggaatcccg
gctttgcctcccttgttctctttgggttatcatcagtgccgctggaactatgaggatgaa
gctgacgtgaagcaggttgatgcgggctttgacgaacacgacatcccatatgatgtcatc
tggctagatattgagcacacagagagcaagtgctacttcacctgggataagcagcgattt
ccaaaccccaaggaaatgcagacacatctgcaggaaaagaaacgcaaggcagtactgtgt
ccttccagttatctcgatttcactcacccagaggctcgagaatggtacgccggccagttt
tcatttgataaatatcagggttcctcggagattctctttgtgtggaatgacatgaatgag
ccatcggtgtttctgggccctgaactgaccatgcagaaggacttggttcaccgaggaggc
tgggagcaccgtgaggtccacaatctctacggattttaccagcaaatggcaacagcagac
ggactgctcctgaggtcaaaagggaaggaaagaccctttgtgctgtctcgggccttcttc
gcggggtcccagcgatatggtgcagtttggacgggggacaacgtggcgaactgggactat
ctgagaatctcaacaccgatgctgctcaccataagcttatgtggcatctcgttctgtgga
gctgatgtaggagggttttaccaggatccagacccagaactcctggtccgctggtaccag
gccggagcttaccagccgttttttagaggccacgcctgcagtgggacgaagcgccgtgag
ccctggctgttgggggaggagaacatgtgtgttatcagagaagcgatccgagagcgctac
gagctgctgccgtactggtacactctcttctaccgagcacacgtcttcgcagaacccgtt
atgaggccaatctgggttgagtttccagacgagatcactacttttggaattgaccacgag
tacttcttaggaaatgctttactggtacatcctgtgacagatgctggggtcaccacagtg
gacgttttccttcctgggtcagatgagatttggtacaacattcgaaccttcaagcgacat
gagggagctcagaccttgtgtgtacctgtcagtattgagagtataccagtgttccagaga
ggaggttcgatcgtccccaggaagactcgagtgtgtagatccactgagtggatgaaggac
attccttatgttctccatgttgccctggacttcaagggctcagctgtgggagagctgttt
ctagatgatggacattcgtttgactaccaggcggagaacaaatttatccacaagagattc
agcttcaacaacaacaccctctcctccagctctgcggatagaagggagcatttccagacc
tcctgtgaggtggaggaagtgttgattatgggattcgaagcagctccgtcctctgtaaca
gtccaaaactcaggtgagaaagaagcagcagtgcgttttaattacgatgctgggacctct
gtgttaacgctggaaaatctttgtgtcaacgttggcaccgagtggacaataaagatacac
agaaacaagtag

DBGET integrated database retrieval system