KEGG   Latimeria chalumnae (coelacanth): 102361167
Entry
102361167         CDS       T02913                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04310  Wnt signaling pathway
lcm04340  Hedgehog signaling pathway
lcm04371  Apelin signaling pathway
lcm04510  Focal adhesion
lcm04530  Tight junction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102361167 (CCND1)
   04340 Hedgehog signaling pathway
    102361167 (CCND1)
   04371 Apelin signaling pathway
    102361167 (CCND1)
   04068 FoxO signaling pathway
    102361167 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102361167 (CCND1)
   04115 p53 signaling pathway
    102361167 (CCND1)
   04218 Cellular senescence
    102361167 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102361167 (CCND1)
   04530 Tight junction
    102361167 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102361167
NCBI-ProteinID: XP_005996284
Ensembl: ENSLACG00000013180
UniProt: H3AZA4
LinkDB
Position
Un
AA seq 292 aa
MENQLLCCEVETIRRAYHDPNLLNDRVLKTMLKAEENSPPSVSYFKCVQKEILPYMRKMV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPIKKNRLQLLGATCMFLSSKMKETIPLT
AEKLCIYTEHSIRAEELLQMELLVLSKLKWDLASVTPHDFIEHFLSKLSLPYDTKQIIRK
HAQTFVALCATDAKFISNPPSMIAAGSVAAAVQGLHLGNTNLILSYQCLTDFLSQTIKCD
SDCLRACQEQIESLLEISLRQAQHHSISSETKTVEDEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaaaatcagctgctgtgttgtgaagtggagaccatcagaagagcttaccacgatccc
aaccttcttaatgacagagtcttaaagacaatgctaaaagctgaagaaaattctcctcct
tctgtatcttacttcaaatgtgtgcagaaggaaattttaccttatatgaggaaaatggtt
gcaacttggatgttggaggtttgtgaagaacagaaatgtgaagaggaagttttcccctta
gctatgaattatttggacagattcttgtcagtggaacccatcaagaaaaaccgattacaa
ttacttggagctacctgtatgtttttgtcctcaaaaatgaaggaaactatcccattaaca
gcagagaagctttgcatttacaccgagcattctatcagagcggaggagttattgcaaatg
gagctgctagttttaagcaagctgaagtgggatctggcttccgtgactcctcacgatttc
attgaacattttctttccaaactgtcccttccgtatgacaccaagcagattatccgcaaa
cacgcccagacttttgtggctctctgtgctacagatgcaaagtttatttcaaatccaccc
tccatgattgcagctggcagtgtggcagcagcagttcaaggacttcacctgggaaacacc
aacctgatcctgtcctatcagtgtcttacagacttcctatcgcaaaccatcaaatgtgat
tcggattgtttacgggcatgtcaagaacagattgaatcccttcttgagataagcttgcgt
caggcacagcatcacagcatatcttcagaaacaaagactgttgaggatgaagtggacctc
tcctgcacaccgactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system