KEGG   Latimeria chalumnae (coelacanth): 102361177
Entry
102361177         CDS       T02913                                 

Gene name
SIAH1
Definition
(RefSeq) siah E3 ubiquitin protein ligase 1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04120  Ubiquitin mediated proteolysis
lcm04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102361177 (SIAH1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102361177 (SIAH1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102361177 (SIAH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lcm04121]
    102361177 (SIAH1)
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102361177 (SIAH1)
Ubiquitin system [BR:lcm04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    102361177 (SIAH1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 102361177
NCBI-ProteinID: XP_005998412
Ensembl: ENSLACG00000014463
LinkDB
Position
Un
AA seq 297 aa
MGRDCLCEPNVVRKQMSRQTATTLPTGTSKCAPSQRVPALTGTTASNNDLASLFECPVCF
DYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGC
EITLPHTEKTDHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVF
LATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRL
ELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 894 nt   +upstreamnt  +downstreamnt
atgggacgggactgtttgtgtgagcccaacgttgttagaaagcaaatgagtcgtcagact
gctacaacgcttccaacaggtacctcaaaatgtgcaccatcccagcgagtgccagcactg
acgggcactacagcttccaacaatgatttggccagtctttttgagtgtccagtatgcttt
gattatgtattgccacctattcttcagtgccagagtggtcacttggtgtgtagcaactgt
cgccctaagctaacatgctgccccacttgtagaggcccattgggttccattcgtaacttg
gctatggaaaaagttgccaattctgtattgttcccttgtaaatatgcctcatctggatgc
gagataactttaccacacacagaaaaaaccgatcatgaagagctttgcgagtttaggcct
tactcgtgcccttgccctggagcatcttgtaaatggcagggctctttggatgctgtaatg
ccacatctaatgcatcaacataaatctataacaacattacaaggtgaagatatagttttt
cttgctacagacattaaccttccaggagctgttgattgggttatgatgcaatcttgtttt
ggttttcatttcatgctagtactggaaaaacaagagaaatatgatggccaccagcagttc
tttgcaattgtacaactgattggaacacgcaagcaagctgaaaactttgcttatcggctt
gagcttaatggtcacaggcgacgactaacttgggaagctactccccgttctattcatgag
ggaatcgccacagccattatgaatagtgactgtctggtctttgatactagcattgcacag
ctttttgcagaaaatggaaatctaggtattaatgtaacaatttctatgtgttga

DBGET integrated database retrieval system