KEGG   Latimeria chalumnae (coelacanth): 102361342Help
Entry
102361342         CDS       T02913                                 

Gene name
PARK7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcm01002]
    102361342 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102361342 (PARK7)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     102361342 (PARK7)
Peptidases [BR:lcm01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   102361342 (PARK7)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102361342 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 102361342
NCBI-ProteinID: XP_005994247
Ensembl: ENSLACG00000008364
UniProt: M3XIY9
LinkDB All DBs
Position
Un
AA seq 189 aa AA seqDB search
MGSKRALLILARGAEEMETVIPVDILRRAGVKVTVAGLAGKEPVQCSRDVVICPDMSLEE
ARKEGPYDVVVLPGGNEGAQNLSQSPAVKEVLKDQESRKGLIAAICAGPTALLAHGIGFG
SKVTTHPLAKDKMMDGGHYTYSESRVERDGNIITSRGPGTSFEFAFAVVESLMGKEVADK
VKAPLVLRD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggggagcaagcgggcgctgctgatcttggcccggggagccgaggagatggagacggtc
atcccggtcgacatcctgcgcagagccggggtgaaagtgacggtggctggactggcagga
aaggaacccgtccagtgtagtcgagacgttgtcatctgccctgacatgagtctcgaagag
gccaggaaggagggcccatatgatgtggtggttttgcctggtgggaatgaaggcgctcag
aacctgtcccagtccccggctgttaaggaagtgttgaaagaccaagagagtagaaagggg
ctgattgctgcaatctgtgcaggtccgactgcattgctggctcatggcattggctttggg
agcaaagtgaccacccatccactggcaaaggacaagatgatggatggagggcactacaca
tactcggaatcccgcgtggaacgggacggaaacatcatcaccagccgcggccctggaacg
agcttcgagtttgccttcgccgtggtggagtcactgatgggtaaggaggtcgcagacaag
gtcaaagccccccttgtcctcagagactag

DBGET integrated database retrieval system