KEGG   Latimeria chalumnae (coelacanth): 102361382
Entry
102361382         CDS       T02913                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04012  ErbB signaling pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102361382 (CDKN1A)
   04068 FoxO signaling pathway
    102361382 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102361382 (CDKN1A)
   04115 p53 signaling pathway
    102361382 (CDKN1A)
   04218 Cellular senescence
    102361382 (CDKN1A)
SSDB
Motif
Pfam: CDI NUP50
Other DBs
NCBI-GeneID: 102361382
NCBI-ProteinID: XP_005987645
Ensembl: ENSLACG00000008728
UniProt: H3AJT0
LinkDB
Position
Un
AA seq 171 aa
MTVEHEKYSFVLQWKAMSLPLEILKSEGGGNVCRNLFGPVDHNQLKKESQEMLLSFAEAA
KHKWNFDFIKETPLNGDLQWERVECSEMPSVYHPCELNGKRRALTNIPQENEKENERRKD
TPCNFSEQASKKDSTALATNSIKSLKRKQTTITDFYHTKRRIIQSSCKAEQ
NT seq 516 nt   +upstreamnt  +downstreamnt
atgacagtggaacatgaaaagtattcttttgtgttgcagtggaaagccatgtctctgcca
ctggagatcttaaaatctgaaggaggtgggaatgtttgcagaaatctctttggacctgta
gaccacaaccagctaaagaaagagtcccaggaaatgctgctgagctttgctgaagccgcc
aagcataagtggaactttgattttataaaagagaccccactcaatggagatttacagtgg
gaaagagttgaatgttctgaaatgccatcagtttatcacccttgtgagcttaatggaaag
cggagagcacttacaaatatccctcaagaaaatgaaaaagagaatgaacgaaggaaggat
acaccatgtaatttctctgagcaagcttcaaaaaaagactcaacggctcttgctacaaac
tcaataaagtcactcaaacgaaaacagaccactattacagacttttatcacacaaagaga
aggatcatacagtcatcatgcaaggcagagcagtga

DBGET integrated database retrieval system