KEGG   Latimeria chalumnae (coelacanth): 102361446Help
Entry
102361446         CDS       T02913                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102361446 (GPD2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     102361446 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 FAD_oxidored GIDA EF-hand_8 Pyr_redox_2 EF-hand_5 NAD_binding_8 HI0933_like FAD_binding_3 EF-hand_9 EF-hand_4 Pyr_redox Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-GeneID: 102361446
NCBI-ProteinID: XP_006001352
Ensembl: ENSLACG00000011119
UniProt: H3ASK0
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFRKVSERAALIGGGALVAVLGLGQFAEYKKTQARLAYAREAEPLDEPLETSLPSRDAQ
LLALQKSKEFDVLIIGGGATGCGCALDAVTRGLKTALVERADFSSGTSSKSTKLIHGGVR
YLQKAIMRLDYEQYKLVKEALQERANLLEIAPHLSSPLPIMLPVYKWFQLPYYWAGIKLY
DLVAGSRCLKSSYILSKTKALELFPMLKKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AAIANYTEVVHLLKKTVSETGKERVCGARCRDLLTGQEFDVKAKCVINATGPFTDIVRKM
DDHKIPNICQPSAGVHIVMPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTIAGTTDTPTD
ITPHPIPREEDINFILTEVRNYLTPDVQVRRGDVLAAWSGIRPLVTNPDSKDTQSISRSH
VVHVSESGLVTIAGGKWTTYRLMAEDSVDAAIQAHDLKARPSRTLGLLLEGARNWTPTLY
IRLVQNYGLENEVAKHLASTYGDKAFEVAKIAKVTGKRWPIVGKRLVSEFPYIESEVRYA
VKEYACTAIDVLARRTRLAFLNVQAADEALPRIVEIMAQELNWNEEKKKEEMKAGKEFLS
TEMGYKPRSEQLNDTTEINLSPSDVDRYKKRFQKFDEKNKGFITIVDVQRVLESISVQID
ENALHEILNEVDLNKNGQVEFSEFLQLMSAIQKGFVSGSRLALLMKTAEETMDQRDTIPV
DRSGGGV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcgcaaggtgtcagaaagggcagctctgataggaggaggtgcactagttgca
gttcttggtcttggccaatttgctgagtataaaaagacccaggctcgtcttgcatatgcc
agagaagcagaacctcttgacgaacctttagaaacaagccttccatcaagggatgctcaa
ctgctcgcattacagaaaagtaaggagtttgatgtccttataattgggggaggagccaca
ggatgcggctgcgctttagatgctgttaccagaggacttaaaacagctcttgtcgaaaga
gcagatttctcatcagggactagcagcaagagtactaaactcattcatgggggagtgaga
tatcttcagaaagcaatcatgagattagattatgaacagtacaagctagtaaaagaagcg
ctccaggaacgcgctaatcttctagagatagctcctcacttatcaagtcctttacctatt
atgcttcctgtttacaaatggtttcaacttccctactactgggcaggaattaagctatat
gaccttgtagcagggagtcggtgtctgaaaagcagttacatcctcagcaaaacaaaagct
ctggaactgtttcccatgcttaagaaagataagcttgttggtgcgattgtgtattatgat
ggacaacacaacgatgcacgaatgaacctcgccatcgccctcactgctgccaggtatggt
gctgccatagccaattacactgaagtggtgcatttgctgaagaagacagtttcagagacc
ggcaaggagcgtgtctgtggtgcacggtgcagagatttacttacagggcaggaatttgat
gtcaaagccaaatgtgttatcaatgccacaggacctttcacagatatagtgcgcaaaatg
gatgatcacaaaatcccaaacatctgtcagccaagtgctggtgtgcatatcgtgatgcct
ggctattacagtcctgacaatatggggcttcttgacccagccactagtgatggacgagtg
atcttttttctgccatgggaaaaaatgacaattgctggaaccactgacactccaacagat
attactccacatcccattcctagagaagaggacattaattttattttgactgaagtacgt
aactatcttacccctgatgttcaagtaagaagaggtgatgtcttggcagcatggagcgga
attcgtcccctggttactaatccagactccaaggatacacagtccatttctcgcagtcat
gtggttcatgttagtgaaagtggattggtaactatagcaggtggaaagtggacaacatat
cgtttaatggctgaagacagtgtggatgcagctatccaagctcatgacttaaaggcaaga
ccaagcaggacactagggcttttactggagggagccaggaattggactcctacactctac
attcgattggttcaaaactatggacttgagaatgaggttgctaagcatcttgcctcaact
tatggtgataaagcctttgaagtggccaaaatagctaaagtgactggaaagcgatggcct
attgttggaaaacgcctggtgtcagagtttccatacattgaatcagaggttcgttatgca
gtaaaagaatatgcatgcacagctattgacgttcttgcccgacgtactcggctagctttt
ctaaacgtacaagcagctgatgaagcactacccagaattgtagagatcatggcacaagag
ctaaactggaatgaggaaaagaaaaaggaagaaatgaaagctggtaaggaatttctgtca
actgaaatgggctacaagccccgatcagagcaattgaacgacacaactgagatcaacctt
tcaccttctgatgtggatagatataaaaagagatttcagaagtttgatgagaaaaacaaa
ggatttattaccattgttgatgtgcagcgtgtattggagagcatcagtgtccaaattgat
gagaatgctcttcatgaaatcttaaacgaagtagacttaaacaaaaatggacaggttgag
tttagtgaatttttgcaactaatgagtgctattcagaaaggctttgtatctgggagtagg
ttggctttgttaatgaaaacggctgaagagactatggatcagagagacactattccagtg
gaccgtagtggtggtggagtgtga

DBGET integrated database retrieval system