KEGG   Latimeria chalumnae (coelacanth): 102361530
Entry
102361530         CDS       T02913                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04060  Cytokine-cytokine receptor interaction
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102361530
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102361530
   04217 Necroptosis
    102361530
   04115 p53 signaling pathway
    102361530
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102361530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lcm04050]
    102361530
   04090 CD molecules [BR:lcm04090]
    102361530
Cytokine receptors [BR:lcm04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102361530
CD molecules [BR:lcm04090]
 Proteins
  102361530
SSDB
Motif
Pfam: Death TNFR_c6 Piwi HetR_C
Other DBs
NCBI-GeneID: 102361530
NCBI-ProteinID: XP_005997640
LinkDB
Position
Un
AA seq 342 aa
MCNRCRRDQVMISSCTSVKNTVCECKPGKYCLPNHTCEICHLCRTSCPKGKVILQRCNAT
SDTVCGLHRENSINSKTQHPSIHPPINSKTQSDNGVDFKVKPILSLCSACRTNPTQLAKD
NEREETSSMDEPTIMIQPSTSPIKSEIVPLLQSSEENPEALGEQNSSCSVSETHSSCMEE
VGQSQRSGGEEVIHKATGYPVLAKDSAKAADLVPSKNCRCYLRRQEILPNWSYLTEVNDS
PEDALVKSFYYIIDEIPAKEWKNFMRNLDIKDHDIDTATEDNPHNSKEQKYQMLRTWYNK
FGKDASICVLLQVLFNMNLKLCADNIIIKLIEKCVYKYCSDN
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgtgtaatcgctgtagacgagatcaggtgatgataagttcctgcacttcagtgaagaat
accgtatgtgagtgtaagcctggcaagtactgcctacctaatcatacctgtgagatctgt
cacctgtgtagaacgagttgtcctaaggggaaggtaatattgcagcgctgtaatgctaca
tcagatactgtttgtggactacatagggagaactccatcaactccaagacacaacatcca
tccatccatccacccatcaactccaagacacagtcagataatggagtggatttcaaagtg
aagcccattttgtcactgtgttctgcatgcagaactaatccaacacaactggcaaaggat
aatgaaagagaagaaactagttccatggatgagccaacaataatgatccagcccagtacc
tctcctataaaaagtgagattgtacctttactccagtcttcagaggagaatcctgaagca
cttggagagcagaacagcagctgctcagtctcggagacacactcttcttgcatggaagaa
gtcggtcagagtcaaagaagtggaggcgaagaagtgattcacaaggctacaggataccca
gttcttgctaaggattcagccaaggctgctgaccttgttccatcaaaaaattgccgttgt
tatttaagacggcaagaaatattgccaaattggagttatcttactgaagtgaatgacagt
cctgaagatgcattggttaagagtttttattacatcattgatgaaattccagctaaagag
tggaagaatttcatgaggaatcttgacataaaagaccatgatattgatacagcaaccgaa
gataatcctcataactctaaagagcaaaagtatcaaatgttaaggacctggtacaataaa
tttggaaaagatgcttctatatgtgttttgttgcaggttctgtttaatatgaatttaaaa
ttgtgtgcagataatataataatcaagttaattgaaaaatgtgtttataaatattgttct
gataactaa

KEGG   Latimeria chalumnae (coelacanth): 102366259
Entry
102366259         CDS       T02913                                 

Definition
(RefSeq) uncharacterized LOC102366259
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04060  Cytokine-cytokine receptor interaction
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102366259
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102366259
   04217 Necroptosis
    102366259
   04115 p53 signaling pathway
    102366259
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102366259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lcm04050]
    102366259
   04090 CD molecules [BR:lcm04090]
    102366259
Cytokine receptors [BR:lcm04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102366259
CD molecules [BR:lcm04090]
 Proteins
  102366259
SSDB
Motif
Pfam: Death TNFR_c6 ETRAMP
Other DBs
NCBI-GeneID: 102366259
NCBI-ProteinID: XP_005992657
LinkDB
Position
Un
AA seq 495 aa
MRKLALPVVLLLAALVALSHAFPQQEHNTQIGKTFNQDALKEEDRGLKRSKQSKKESVCG
EDEYLHGEHCCKMCPAGTSVKEGCVTPHKDSICKSCIQGQDYTTGPNGLPNCVSCQKCKA
AAGKRMVSECTITKDTVCKCQAEKFCPRNHPCEVCKWCKKCPEGQEVKRPCTATTDTGCG
SIPAIDHVVPLTNSTSEPASEGQTYVSILLSVLITTILVVIFLIVCCCNKKCNKKATEIR
KKLHLVRRMSIDSKKQSTFFFSDKEIAENSINSQIVQSTGNPTEEEMVSPLLRDSGRSTP
SLHTKAAGEDSSTADQFDPTSHLSVSQNENGHLILPLGPDSECLPVANPSLMGSSKFNGE
IEMVAESGATLDRQDKIGLQNVQLGNTLHLGREQLLKNEDLHPKDLRDTFYIFVSEVPVN
SFKEFMRRLKLTENDIEVAVVENPQNIKNQYYKMLYTWLLLRGKEASIQNLLDVLYEMNL
KATAEKISEQLVKNE
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgagaaagttggcgcttccagtagtgctcctgctcgcagctttagtggcattatcgcat
gcattcccccaacaagaacacaacacccaaattggaaagactttcaatcaagatgcactg
aaggaggaagacaggggtttaaaaagaagtaaacagagcaagaaggaaagtgtttgtgga
gaagatgaatatctgcatggggaacactgttgcaagatgtgcccagcaggtacttctgtc
aaagaaggatgtgtgacacctcacaaggatagtatctgcaagagctgtatccagggacag
gactatacaacagggcccaatggactaccaaattgcgtatcttgccaaaaatgtaaagca
gctgcagggaaaaggatggttagtgaatgcactataacaaaggatacagtctgcaagtgc
caggctgaaaaattctgtcctcgaaatcatccctgtgaggtctgcaagtggtgtaaaaag
tgtccagagggacaggaagttaaaaggccatgcactgcaacaaccgacacaggatgtgga
tcgatcccagccattgaccatgttgtccccttgactaacagtacctctgagccagcttct
gaagggcaaacctatgtttccattctcctatcagtgcttataactacaattttagtagtt
atctttttgattgtttgttgctgcaataaaaaatgcaacaagaaagctacagagataaga
aagaagcttcatttagtgagacgaatgtcaattgattccaaaaagcagtccacttttttt
ttctctgacaaagaaattgcagaaaacagcattaattctcagattgttcaaagtactggt
aaccccactgaggaagaaatggtttcacctttgctccgggactcgggcagatccactcca
agtctacacaccaaagctgctggagaagattcctcaactgcggaccagtttgaccccaca
agtcacttatctgtcagccagaatgaaaacggtcatctcattctacctcttgggccagac
tcggaatgtctacctgtggctaacccaagtttaatgggaagcagcaagttcaatggagaa
attgagatggtggctgaatcgggagctactctggatcgacaggacaagattgggcttcaa
aatgtgcaactcgggaacacattgcacttgggaagggagcagcttctgaaaaatgaggat
ttgcatcctaaagatctgagagacactttctacatatttgtatccgaagttcctgtaaac
agctttaaagagtttatgcgacggttgaagctgacagaaaacgatattgaagtggcagtc
gtggaaaatccccagaacattaagaatcagtattataaaatgctgtatacctggctgctg
ctaagaggaaaagaggcctccatacagaacttgctggatgtcctttatgaaatgaacttg
aaagcgactgcagaaaaaatctctgagcagcttgtcaaaaacgagtag

KEGG   Latimeria chalumnae (coelacanth): 102366681
Entry
102366681         CDS       T02913                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04060  Cytokine-cytokine receptor interaction
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102366681
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102366681
   04217 Necroptosis
    102366681
   04115 p53 signaling pathway
    102366681
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102366681
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lcm04050]
    102366681
   04090 CD molecules [BR:lcm04090]
    102366681
Cytokine receptors [BR:lcm04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102366681
CD molecules [BR:lcm04090]
 Proteins
  102366681
SSDB
Motif
Pfam: Death TNFR_c6 DUF3827 Insulin_TMD
Other DBs
NCBI-GeneID: 102366681
NCBI-ProteinID: XP_005992659
LinkDB
Position
Un
AA seq 404 aa
MLYCRYFCFTTMEVKSHIFAVLLMLAVVWRVVEPAALRSPALEEWTAQPEPTPGGLVAEK
EEGKHRAVRETCGKNQYLFQKGHCCLMCPKGHYVKTPCVAPNISVICAPCIEGKEYTEDA
NGLERCLSCRRCRKDQDVVSVCTAEKNTVCQCKQGTFCQPNRTCEICQRCKTSCPKDLEK
LSDCNATTDLTCGPSLQGNVWIIVGPILAFLVLSICVVFFYWRCHRANSAEDSGSLNILR
RATSFLTPVLKGDCQETHDNVWNTNIDEAKVPLRGKLENATMTGCSPTKKEEVTRPLVAA
KELPEVLTKSFYTFINEVPNKEWKKFMRLLHLTDNEIWVAERNHPSDIREQYFQMLNTWQ
SCTGKEASINTLLQTLRDMNLKGVEERITASLIQEGIYKYSTEN
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgttgtattgtcggtatttttgttttaccaccatggaagttaaaagtcatatatttgca
gtcctcctaatgttagctgtcgtatggagagtggtggagccagctgctctgcgtagtcca
gcacttgaagaatggacagcacaacctgagcccacaccaggaggtttagtggcagaaaag
gaagaaggaaaacacagggctgtccgggaaacctgtggaaagaaccagtatctgtttcag
aaaggccattgctgtctcatgtgccctaaaggtcactatgttaaaaccccttgtgtggct
ccaaacatatcggtgatctgcgccccatgtattgagggaaaggaatatactgaagacgct
aatggcctggaacgctgtctgtcgtgcagacgttgtagaaaagatcaggatgttgtgagc
gtgtgcactgcggagaaaaacacagtctgtcagtgtaagcagggtactttctgtcaaccc
aaccggacatgtgaaatttgtcagcgatgtaaaaccagttgtcccaaggacttggaaaaa
ctaagtgactgcaatgctaccacagatttaacttgtggaccttccctacaaggaaatgtt
tggattattgttggacccatacttgcattcctagtactctcgatctgtgttgtatttttc
tattggagatgccacagagccaattctgctgaagactctggttctctcaacatcctcaga
agagcaacgagtttcttaacacctgtgctcaaaggtgattgccaagaaacccatgataat
gtctggaacacaaacattgacgaagcaaaggttcctctaaggggaaagctagagaatgca
accatgactggttgtagcccaacaaaaaaggaagaagttactaggcctcttgttgcagcg
aaagagctcccagaagtacttactaaaagtttttacacatttataaatgaagtacccaat
aaggaatggaagaagtttatgagactgcttcatcttacagacaatgagatttgggtggca
gaaagaaaccacccttctgatattcgtgaacagtattttcagatgttaaatacttggcag
agctgcactggaaaggaggcctccataaacacgttactgcagaccctccgtgacatgaac
ttgaaaggtgtcgaggaaaggatcacagccagtttgatccaagagggaatctataaatac
tccacagagaactaa

DBGET integrated database retrieval system