KEGG   Latimeria chalumnae (coelacanth): 102361707
Entry
102361707         CDS       T02913                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22-like
  KO
K10136  TP53 apoptosis effector
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102361707
SSDB
Motif
Pfam: PMP22_Claudin Claudin_3 L_HMGIC_fpl DUF973 Claudin_2 MARVEL DUF3169 Clc-like Ferric_reduct Pox_A14 DUF373 YwcE DUF2700 ABC2_membrane_3 Wzy_C
Other DBs
NCBI-GeneID: 102361707
NCBI-ProteinID: XP_006000523
Ensembl: ENSLACG00000013261
UniProt: H3AZJ8
LinkDB
Position
Un
AA seq 183 aa
MLSCGIAYSRCRWILPLLLLCALIFDIIALAGSGWVTSERHFSSLWKHCRGKEEPYECES
LMNYGWGQASAAMILIGFILLIICVLLSFMALCKNESVRELLVLIGLVLFIAVLFHFVGL
IIYPVKFTDELINEGHYEYSWSYGFAWGCTILMIGCGIVFCCLPSHEDEFLGHVKPKPLY
TFS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgttgagctgtgggattgcctactccaggtgccgatggatcctgcctttgctgctgctc
tgcgccctgatatttgacattatagccctggccggttcgggctgggtcacgtcagagaga
cacttttcctctttgtggaagcactgccgcggcaaggaggagccctacgagtgcgagtcc
ctcatgaactacggctggggacaagcttcagctgccatgatcctcatcggcttcatcctg
ctgatcatctgtgtgcttctgtccttcatggccctctgtaaaaatgaatctgtaagagag
ctgttggtgttgattggattggtcctctttatagctgtcctcttccactttgttgggttg
atcatttacccagtgaagttcaccgacgaactgattaatgaaggtcactacgaatacagc
tggagctatggctttgcctggggctgcaccatcctgatgattggctgtggcatcgtcttc
tgctgcctccccagccatgaagatgaattcctgggtcatgtcaagcccaaacccctctac
actttctcataa

KEGG   Latimeria chalumnae (coelacanth): 102361982
Entry
102361982         CDS       T02913                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22-like
  KO
K10136  TP53 apoptosis effector
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102361982
SSDB
Motif
Pfam: PMP22_Claudin Ferric_reduct Clc-like Claudin_2 DUF973 DUF373
Other DBs
NCBI-GeneID: 102361982
NCBI-ProteinID: XP_006000524
Ensembl: ENSLACG00000013775
UniProt: H3B177
LinkDB
Position
Un
AA seq 182 aa
MFKCGFAYPRCRWILPLLLILTLIFDIIALTGSGWVMSSGKHFASLWKHCDEFNGSQQCE
SLMNYGWGQAATAMILIGFILLIICVLLSFKMCCTPSMSFLKLIGFILFVAVLFHFIGLI
IYPVKFTDKLINEGHYEYSWSYGFAWGCTILMFGCGIFFCCLSNYEDELTGNAKPSYLYT
SS
NT seq 549 nt   +upstreamnt  +downstreamnt
atgttcaagtgtgggtttgcttaccccaggtgccgatggatcctgcctttgctgctgatt
cttaccttgatatttgacattatcgccctgaccggctcaggctgggtcatgtctagtggt
aaacactttgcctccctgtggaagcactgtgatgaattcaacgggtcacagcaatgcgag
tccctcatgaactacggctggggacaagctgcaactgccatgatcctcatcggcttcatc
ctgctgatcatctgtgtgcttctgtccttcaaaatgtgctgtacaccaagcatgtccttc
ctgaaactgattggtttcatcctcttcgtagctgtcctcttccactttattgggttgatc
atttacccagtgaagttcactgacaaactgattaatgaaggtcactacgaatacagctgg
agctatggctttgcctggggctgcaccatcctgatgttcggctgtggcatcttcttctgt
tgtctctccaactacgaagatgaattaacgggcaacgccaagcccagctacctctacact
tcctcataa

DBGET integrated database retrieval system