KEGG   Latimeria chalumnae (coelacanth): 102361997Help
Entry
102361997         CDS       T02913                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00052  Galactose metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102361997 (LCT)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     102361997 (LCT)
    3.2.1.108  lactase
     102361997 (LCT)
Chaperones and folding catalysts [BR:lcm03110]
 Intramolecular chaperones
  Others
   102361997 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 102361997
NCBI-ProteinID: XP_006006254
Ensembl: ENSLACG00000008371
LinkDB All DBs
Position
Un
AA seq 1912 aa AA seqDB search
MNAGMELSSTLVIALLFVPCFGTDWQFAYNFALISGPLTNDLINGLEGTEKGMNNDGFST
FTAVSALEARICQEPFPVYLKDYFSDLHVRGVTHYKVILPWRTILLNGTSNNPDKSKIEC
YRSLLNELSTAKLKPVVILHQGALPAVLISGYRGWNQRFLASLFADYAEFVFRALGDMAD
TWITFSDPTETISATLTENPKESFSMALKTIVSAHKKVYKIFHNGFASNGGKLSIALGID
DVIKESTFSRELEEVSKINVFSTDKHAKTLAVWCPEPHKQHKGFVDFIAVNVQYDCETQA
DMREKLGRIRQETSHSVNSKYQRISKTSPLSYQTVWEKFANQSDSERDSFLYGTFPNDFL
WGTATASFKIEGGWKEYGKGESIWDTFGHNGHAYNNLTADVSCDSYNKIDYDIYLMRGLQ
SNIYKFSISWSRIFPTGYRNSLNKKGVDYYNKLINRLLGSNIQPMVTLFHWDLPQALQDL
GAWQNETIIDTFVEFADFCFATFGDRVKTWITFNEPWVVSYAGYGTGQHAPKITDPGVAS
YKVAHSILKAHAKAWHVYNDKYRSQQHGQVGIALNSDWVEPKSHNNTEDIKAAERYIQFM
LGWFAHPIFVNGDYPEILKTQIENKNLECGKVIGQLPAFTEEEKLYIKGTADFFGVSHYT
SRIVSATTNKICTSEYNNIGDFTQHVHPSWPRALSSWIYVVPWGFRRLLNFIAQEYTGNK
IPIYITGNGVPTEYAGDVINDTIRINYFNTYINEALKANKVDRVDIKSFILWSLLDNFEG
PQGYNQRFGLHYVNFENPNRPRTPKESAYFYSKLIEQNGFRNDASKDVIQLQESHLDLLR
LPELPASEVPSEAKIVWEKFSKQSDSDKNLFFYGTFPDDFAWGVSTSAYQIEGGWNADGK
GPSIWDNFTHSPNNVLNNENGDIACDSYNKIDEDLYMLRALKVKSYRFSLSWSRIFPNGT
KESANPKGVVYYNRLINGLLKSNIIPMVTLHHWDLPQALQDAGGWDNNQLVDLFNEFADF
CFQSFGDRVKFWMTFNQPYSIAWEGYGLGIHPPKVKDPGLAPYRIAHTLIKAHAAVYHTY
DQKYRPSQKGLISLSLNANWAEPKNPDEPTDVAAADRYLQFMLGWFAHPIFKNGDYPDVM
KGHIASKSELQGLSSSRLPHFTDTEKAYIQGTADAFCINAYTTKIIRHKISRLKPYSYED
DRDLSEEVDVTWPTSAMKELRPVAWGLRRLLNWIKEEYNNPPTYITENGVASSSDSSVDD
IDRIFYYKTYIDEALKAYKLDGVNLKGFIAWSLMDCFEWTDGYNLRFGLHHVDFISASRQ
RTPKRSAHYYAELIMNNGIPLQKEDEFLYGEFPKGFAWSVATAAYQIEGGWRADGKGLSI
WDTYTHTPFKIGNGQTGDIACDSYNKIEEDVAMLKNLMVTHYRFSLSWPRILPDGTTRYI
NEAGLNYYNHLIDALLAANIKPQVTLYHWDLPQALQDVGGWENETIVERFKEYADVIFNR
LGDRVKFWITVNEPYNVANIGHGYGVAAPGISTRPGTAPYIVGHNLIKAHAEAWHLYNDT
YRAKQGGLISITINSDWAEPRNPYKQEDIDSARRFMQFYGGWFAHPIFKTGDYNEVMKNR
ILERSLANGLLKSRLPEFTETEKQRIKGTYDYFGFNHYTTVMTFNFNYGKLQSYDADRGV
GAVTDRSWLNSGSSWLKVTPFGFRRILNWIKEEYNNPPIYITENGISERGEPDLKDTWRI
NYLKSYINEALKAVKLDGVDLRGYTAWTLMDNFEWAMGFSERFGLYYTNLSDTSIPRIPK
ESTKFYSTVIQCNGFPDTSMGPPACLQPSEGTTTAKPTSTTASAKPDNDDGKVSFLGLLL
STSNAEVALYILFALLILFTLGIVFISFTAKKLQKRLKASKLRLNSVKLERM
NT seq 5739 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctggtatggagctgagcagcaccctagtaatagctctcctcttcgttccttgt
tttggaacagattggcagtttgcttataactttgctctaatttctggtcctctaacaaat
gatctgattaatggtttagaaggtactgaaaaagggatgaataatgatggcttctctaca
tttacagctgtatctgctctggaagccaggatttgtcaggagcctttcccagtttatctg
aaggactatttctcagaccttcatgtgagaggggttactcattataaagtcatattgcct
tggagaaccatattgctaaatggtacctcaaataatccagacaagagcaagattgaatgc
tacagaagtctcctgaatgaactctccactgcaaagctcaagccggtggtaattctgcac
caaggagctcttcctgcggtattgatctcagggtacagaggatggaatcagaggtttctt
gctagcttgtttgcagactatgctgagtttgtgtttagagctttgggtgacatggctgat
acctggattacatttagcgatcctaccgagaccatcagtgcaaccctaactgaaaaccca
aaggagtccttctccatggctctcaagacaattgtttccgcccacaaaaaagtttataaa
atcttccataatggctttgcttcaaatggtgggaagttgtctattgcactgggaattgat
gacgtgattaaagagagcaccttctcgagggagctagaagaagtttccaagataaacgtc
tttagcacagataaacatgctaaaaccttggctgtatggtgcccagagccccataagcag
cacaagggatttgtagatttcattgccgtcaatgtccagtatgattgtgagactcaggca
gacatgcgggaaaagcttggaagaatacggcaagaaacaagtcactctgtcaacagtaag
tatcagaggattagcaagacttcccctttatcttatcaaacagtttgggagaagtttgct
aaccagtccgattcagagagagactctttcctgtatggaacattccctaatgatttcctc
tggggcacagccactgcatcctttaagattgaaggaggatggaaagaatatggaaaagga
gaaagtatttgggatacatttggacataatggacatgcgtataataacctgacagcagat
gtttcttgtgatagctataataagatagattatgatatctacctaatgagagggctgcag
tccaacatatataagttctccatatcatggtcgagaatttttcccacaggctacagaaac
agcttgaataagaagggagtggattattacaataagctaataaaccgcttgctaggttct
aatattcagccaatggtgacattattccactgggatcttcctcaagcactgcaggaccta
ggtgcttggcaaaatgaaactattatagatacgtttgttgagtttgcagatttctgtttt
gccacttttggagatcgagtgaagacatggatcacatttaatgagccttgggtagttagt
tatgctggatacggcaccggacaacatgcccctaaaatcactgatccaggagttgcatca
tataaggtggcccattcaatactcaaggctcatgcaaaggcttggcatgtttacaatgac
aaatatcgttctcaacagcacggtcaagtgggaatagcattaaattcagattgggtagaa
ccaaaatctcacaacaacactgaagacattaaagctgctgaacgctacatacagttcatg
ttaggctggtttgctcatcctatttttgttaatggtgactacccagagattctgaaaacc
cagattgagaataagaacctagagtgtggtaaagtgattggacagctaccagcattcaca
gaggaagagaagttgtacataaagggaactgcagacttctttggtgtaagtcactataca
tctaggattgtcagtgctactacaaataaaatatgtacttctgaatataacaacattggc
gatttcactcaacatgtacatccttcttggcctcgagctttgtcgtcatggatctatgtt
gtaccttggggttttaggaggttgctcaactttatagcccaagaatatactggaaataag
attccgatttacataacaggaaatggcgtacctacagaatatgctggtgatgttattaat
gacactatacggataaactacttcaacacctatatcaatgaagctctgaaagcaaacaaa
gtggatagagtggacataaagtcatttatattatggtcacttttggacaactttgaaggt
ccacaaggatacaaccaaaggtttggactgcattatgtcaattttgaaaatccaaacagg
cccagaaccccaaaggaatctgcttatttctattccaaactcatagaacaaaatggattt
agaaatgacgcttccaaagatgttattcagcttcaagaatctcatttagacctgctcagg
ctaccagagctaccagcatctgaggttccatctgaggctaagattgtctgggagaagttt
tctaagcagagcgatagtgacaaaaatcttttcttttatggtactttcccagatgatttt
gcttggggggtgtccacatcagcctatcagattgaaggtggctggaatgcagatggtaaa
gggcctagtatctgggacaacttcacccacagtccaaacaatgttctgaacaacgaaaat
ggagatatagcctgtgacagttacaataaaatagatgaagacctctatatgctgagagcc
ttgaaggtaaaaagctaccgcttctctctgtcatggtctagaatttttcccaatggaaca
aaagagtctgcaaaccctaaaggagttgtgtattacaacagacttatcaatggcctactt
aaaagcaatataattccaatggtgactcttcatcactgggacctaccccaagcattacaa
gacgctggtggctgggataacaatcagttagttgacctatttaatgaatttgcagatttc
tgcttccaatcttttggggacagggtaaagttctggatgacatttaaccaaccttattcc
attgcatgggaaggatatggcttgggaatacatccaccaaaagtgaaggatccaggtcta
gctccatatagaattgcccacacactaataaaagcccatgctgcagtctatcatacatat
gatcagaaatataggcccagtcagaagggcctcatctctcttagcctaaatgcaaactgg
gctgaaccaaagaatcccgatgaacctacagatgtagcagcagctgatcgttatctgcag
tttatgttgggctggtttgcccatcctattttcaaaaatggtgactacccagatgtcatg
aaagggcacattgcaagcaagagtgagctacaaggtttgtcatcctctaggcttcctcat
tttacagacactgaaaaagcttatatccagggtactgctgatgccttttgtattaatgca
tacactaccaaaattatacgtcataaaatcagccgattgaaaccatattcttatgaagat
gacagagatttatctgaagaagttgatgtaacttggcctacttctgcaatgaaagaatta
aggcctgtagcctggggtctaaggaggctgttgaactggataaaagaagaatataataac
cctccaacttacatcacagaaaatggagtagcatctagttctgattccagtgttgatgac
attgatagaattttttattataaaacatacattgatgaagctctaaaagcttacaaattg
gatggcgttaatttaaaaggatttatcgcttggtccctcatggattgttttgaatggacc
gatggctacaatttaagattcggactgcatcatgtagactttataagtgcaagcaggcag
aggactccaaaacgctctgcacattattacgcagaactcataatgaacaatggaatccca
ctacaaaaagaggatgaattcctttatggagaatttcccaaaggttttgcatggagtgta
gcaacagcagcctatcagattgaaggtggctggagggctgatggaaaaggacttagcatt
tgggatacctatactcacactccatttaaaattgggaatggtcaaactggtgacattgct
tgtgatagctataataaaatagaagaggatgtggcaatgcttaagaacttgatggtgaca
cactaccgtttttcgctgtcctggcctcgtattcttcctgatggaactacacgctacatt
aatgaagctggactgaactactataatcaccttattgatgctctcctcgcagcaaatatc
aaacctcaggtaactttatatcactgggacctgcctcaagccttgcaagatgttggaggc
tgggagaatgaaacaatagttgagagatttaaagaatacgctgacgtcatcttcaacagg
ctgggggacagggtgaagttctggataactgtgaatgaaccatataatgtagcaaatata
ggtcatggttatggtgttgcagcaccaggaataagtacaagaccaggaacggcaccttat
attgttggacacaacctaataaaggctcatgcagaagcttggcatctatacaatgacact
tacagggcaaaacaaggaggtttaatatcaattacaataaactcagactgggctgagccc
agaaacccttacaaacaagaagatattgattctgccagaagatttatgcagttctatggt
ggctggtttgcgcatcctattttcaaaactggtgattacaatgaggtgatgaaaaacaga
atccttgagagaagcttggcaaatgggctgcttaaatctcgactcccagaatttactgaa
actgagaagcagagaatcaaaggtacttatgattactttggtttcaaccactatactaca
gtcatgacattcaactttaactatggaaaactacagtcttacgatgcagacagaggagta
ggtgctgtaactgatcgcagttggctaaattctggctcgtcatggttgaaggtgacgcct
ttcggtttcagaaggatcctaaactggataaaggaggaatacaataaccctccaatttat
atcacagaaaatggaatttctgaacgaggagaaccagaccttaaagatacttggagaata
aactacttgaagagttatattaatgaagctttgaaagctgttaaactagatggtgttgat
ctgagaggttacacagcttggactttgatggacaactttgaatgggctatgggtttttct
gaaagatttggcctatactataccaacttatcagatacttctattcctcgcattcccaaa
gaatccaccaaattctattcaacagttatacaatgtaatggcttccctgacacatccatg
gggcctcctgcttgcctacagccaagtgaaggtaccaccaccgctaaacccaccagcacg
acagccagtgccaaaccagacaacgatgatgggaaggtctcttttctgggattactattg
tctacatcgaatgcagaagtagctctatacattctctttgctttactgatcctctttact
ctcggtatagttttcatttcattcacagcaaagaaactgcagaaaagactgaaagcttca
aaattgcgtttaaactctgtcaaattagaaaggatgtag

DBGET integrated database retrieval system