KEGG   Latimeria chalumnae (coelacanth): 102362131Help
Entry
102362131         CDS       T02913                                 

Gene name
LPAR3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102362131 (LPAR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lcm04030]
    102362131 (LPAR3)
G protein-coupled receptors [BR:lcm04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102362131 (LPAR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF4564
Motif
Other DBs
NCBI-GeneID: 102362131
NCBI-ProteinID: XP_005993913
LinkDB All DBs
Position
Un
AA seq 402 aa AA seqDB search
MKSDCLSESPAPPQLTLGTSIKVKQASPAAGIQLSSQTPATMNECHYDKLMDFFYNNSKI
QTEREWTESTLVVLCFGASFCLFIFISNALVIAAVVRNKKFHFPFFYLLANLAASDFLSG
IAYVYLMFNTGPVSKTLTVHLWFLRQGLLDTSLSASLANLFVIAVERYLSILRMKIHSNL
TKRRVTFLIVLVWTVAIFMGAVPSLGWNCICNIATCSSLAPIYSRSYLIFWTVSNLFAFF
IMIMVYLRIYFYVKKRTNVLSSHTSGSISHRKTPVKLMKTVMAVLGAFVVCWTPGLILLL
LDGLHCINCRVQTMKKWFLILALLNSGMNPIIYSYKDEEMWSTLKKMIYCFFCKLTGQSS
RPSSTVQNRNTELSSHYMEQSITDKTAESGDDSCHDKGSCLV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgactgtctgtcggaaagcccagctccaccgcagctaaccctcggtacctcc
attaaggtgaagcaagcgagtccggcggcggggatccagttgagcagtcaaactccagcc
acaatgaatgaatgccactatgataagctcatggattttttttataataacagcaaaatt
cagacagaaagagaatggacagagtcaactcttgtcgtcttgtgctttggtgcatcattt
tgtttatttattttcatttccaatgcactggtcatagctgcagtggtcagaaacaagaaa
ttccatttcccttttttttatttattggccaacctagcagcttcagactttctatctgga
attgcctacgtttatttaatgtttaacactgggcctgtgtcaaaaacattaacagtgcac
ttatggtttttgcgacagggacttcttgatactagtctctctgcctctttggctaattta
tttgtaattgcagtagaacgctatctgtcaatactgaggatgaagattcatagcaatctt
acaaaaagaagggtaacttttttgattgtacttgtatggacagttgcaatttttatgggt
gctgtgcccagtttgggctggaactgcatttgcaacatagctacttgctcctcattggca
ccaatctacagtagaagttaccttatattctggacagtttctaatctctttgcatttttc
atcatgataatggtatatctgaggatatacttttatgtaaagaagaggactaatgtttta
tcttcacatactagtggttccattagtcatagaaaaacaccagtgaaactcatgaagact
gtgatggcagttttgggtgcatttgtagtctgttggaccccaggattaattctcctccta
ctagatggtctccattgcattaactgcagagtacagacaatgaaaaagtggtttctcatt
ctagctttgttgaattctggcatgaacccaatcatctattcttacaaagatgaagaaatg
tggagcaccctgaaaaaaatgatctactgcttcttttgtaaattaacaggtcagtcctca
agaccatcttcaacagtacaaaatagaaacaccgaattaagcagtcattacatggaacaa
agcattactgataaaacagctgagagtggagatgattcatgtcatgataaaggatcatgt
cttgtgtga

DBGET integrated database retrieval system