KEGG   Latimeria chalumnae (coelacanth): 102362147
Entry
102362147         CDS       T02913                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102362147 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcm04052]
    102362147 (EPO)
Cytokines and growth factors [BR:lcm04052]
 Cytokines
  CSF and other factors
   102362147 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102362147
NCBI-ProteinID: XP_005999842
Ensembl: ENSLACG00000022589
UniProt: M3XJ62
LinkDB
Position
Un
AA seq 179 aa
MGILGFFTLLLLLLLGCTKPVKTTPVRPVCDTSVMDKFIEDAKDAESFVNGCTEACELPV
DMTLPATKVNIKEWNEMDNKIKEREIWAGINLFTHTFKTVRDFIRDSVTVYHITKSYSNT
RSTAQILKRLHTQEIPVPDSPPQKTVVVRTLGELFHIHVNFLRGKVKLFISDACSMQKR
NT seq 540 nt   +upstreamnt  +downstreamnt
atggggatacttggattttttactttgttgctcttgttgctgttgggatgcacaaagcca
gttaagaccactccagtccggcctgtttgcgatacctcggtcatggacaagttcatcgag
gatgccaaagacgctgagagttttgtgaacggctgtacagaggcctgcgagctcccagta
gacatgacgcttccggctacaaaagtgaacattaaagaatggaatgaaatggacaataaa
ataaaagagagagagatctgggcggggatcaacttgttcacccacacattcaagacggtg
agagacttcatccgagacagcgtgacggtgtatcacataaccaaatcctacagcaatacc
agaagcacagcgcagatcttaaagcgtctgcacacgcaggagatcccggttcccgattcc
ccaccacagaagacggtggttgtaagaactttgggggaactttttcacatccatgtcaat
ttcttacgtgggaaagtcaaattatttatcagtgacgcttgcagcatgcaaaaaaggtga

DBGET integrated database retrieval system