KEGG   Latimeria chalumnae (coelacanth): 102362201
Entry
102362201         CDS       T02913                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102362201 (CACNA1E)
   04020 Calcium signaling pathway
    102362201 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcm04040]
    102362201 (CACNA1E)
Ion channels [BR:lcm04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102362201 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102362201
NCBI-ProteinID: XP_014341084
LinkDB
Position
Un
AA seq 2174 aa
MARFGEAMVGRLGSGDGGSEHSRSRQGAPVSSGGTPAAFKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKIIDWPPFEYMILATIIANCIVLALEQHLPGDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFAFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHKTCYGNNSETGEMEAHEPQYPCGTQKCPDSYECREWIGPNDGITQFDNILFA
VLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKER
ERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALDVLRRATIKKG
RMESIRRDPSEEHCADISSVGTSFARASIKSTKLDGTSYFRRQEKLLRISVRHMVKSQAF
YWTVLSLVALNTMCVAIVHHKQPVGLSNFLYYAEFLFLGLFLSEMFLKMYGLGPRLYFHS
SFNCFDCGVVVGSIFEVIWSVFRPGMSFGISVLRALRLLRIFKITKYWASLRNLVVSLMN
SMKSIISLLFLLFLFIVVFALLGMQLFGGGFNFNDGTPSANFDTFPSAIMTVFQILTGED
WNEVMYNGIRSQGGVSSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQE
AEEAFNQKHALQKAKEVSPMSAPNMHSTDKEKKKRHAMSIWEQRTSQLRRHRQMSSQEAL
YKDEMEDLTSEFHQKAKLEEDISTRSEEEEAGREDPESGAQQTQEGDPEKLPVNNHCQGI
EEKRSPSPTSPVEKESRHINSCSLTQDLPGQEDPLAIDGSKDKRWERRSRHRKMRGEGEA
KASSHKKGSRLASRERRGTEEDGQEGENSKEKKHGQEEGKETTRERRRERVSPALDSAAA
HSDATATEMNSPGTHHDETDDNVKNNKLVLLDSSAQDSSEQAQPINQPAKPKNSFSMEES
SHPLIPTDSEKLSGHTNFIIEVTDTHGPVDSIVIPGEFFVKLSSAKMIDQGLILHEGSYF
RDLWNILDFIVVVGALIAFALTTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCV
VTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFYYCTDRSKDLQKDCVGRFVDHEKSKIT
VEEREWKRHDFHYDSIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSPGNRMEMSIF
YVIYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQ
NRHTYQYRVWHFVVSPSFEYTILTMIALNTVVLMMKYYSAPTAYDLVLKYLNIAFTVLFS
LECILKIIAFGFLNYFRDTWNIFDFITVVGSITEIILSDSKTFNMSFLKLFRAARLIKLL
RQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLNEETQINRHNNFR
TFFSSLMLLFRSATGEAWQEIMLSCLSGKKCEIDTSATNGTDENVESCGTDLAYFYFVSF
IFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDKAACGKIHYKDMYK
LVRAISPPLGLGKNCPYRVACKRLVLMNMPVDEDMTVHFTSTLMGLIRTALDIKIAKGGA
DRQQLDSELQKEILLIWPHISQRMLDLLVPIHKASDLTIGKIYAAMMIMDYYKQSKAKKQ
RQQLEEQKLAPMFQRMDASSLPQEIISSAKTLPYLHQNTGPGLGSLSTFVPLSPLSPQEM
FQPLRLIALEKGRPEDPHRNMTPEPERKELKRVPYSSRGLSYLPIETHGRVSSMRASSMP
WLAIEPQVVTDAIAMRRSFSTIGDQRVNGSWLDEYSLERASPDELCKEHRRSCRSSLRLS
GQHLNIDSGLRPDTHHSAEQERGRSRERKHLLSPDVSRCNSEERRQLPHHQSRERRHSRS
PSEGRSQTPQRQGMDLESESPAASTSDTSTPRRGRRQLPQTPLKPRPHILYSPVVRRSMN
TSPPLNGVAARTKEQPPKTAKTDQSEVSQNESSLPAQSSIGGSLGSTPHNYISDPFLALQ
GDIKCPSTTTTDGELTFEAALATSFGRSNTIGSAPPLRHSWQVPNGHFRARLSQLGSSTA
ACDLVSDTDEDDRC
NT seq 6525 nt   +upstreamnt  +downstreamnt
atggctcgttttggggaggcgatggtgggaaggctcggatccggggatggaggctcagag
cacagcagaagtcggcaaggagccccggtgtcttcaggaggaaccccggcagctttcaag
caatcgaaagcccaaagagcaaggacgatggctttatacaaccccattcccgttagacaa
aactgcttcactgtcaacagatctttatttattttcggagaagataatattgtgaggaaa
tatgcaaagaagatcatagattggcctccatttgaatacatgatcctagcaacaattatc
gccaactgcattgttctggctctggagcagcacctccctggggacgacaagactccaatg
tcacgcagacttgaaaagactgagccgtactttattggaatcttttgctttgaagccggg
atcaaaatagtcgccctgggatttgccttccacaaaggttcttatctacggaacggctgg
aacgtgatggactttattgtggttctcagcggtatcctagcaacggctggaacacatttc
aacacccatgttgacttgcggaccctgagggctgttcgtgtgttgagacccctcaagctg
gtctcaggaatccccagtttacaaatcgtgttgaagtctatcatgaaagccatggtgccc
ctccttcagattggactgctgctattctttgccattttaatgtttgctattatagggcta
gaattctacagcgggaagctccacaaaacctgttatggtaataactcagaaactggtgag
atggaggctcatgaaccccagtatccctgtgggacacaaaaatgcccggacagctacgaa
tgtagggaatggattggtccaaatgatggaatcactcagtttgacaacatcctgtttgca
gtgctcactgtcttccagtgcatcaccatggaaggctggaccactgtcctttacaatacc
aatgatgccttaggagctacctggaactggctctactttatccccctgatcattattggc
tccttctttgtactcaacctggtcctgggagtcctttctggggagtttgccaaagagaga
gagagagtggaaaacagaagggccttcatgaagctgcgacgacaacagcagattgaacgg
gaactgaacgggtaccgagcctggatagataaagcagaagaagtaatgttggctgaagaa
aataaaaactccggaacatctgctctggatgtgctcagaagggcaaccataaaaaaaggg
cgaatggagtccatccgtcgagatcccagtgaagagcactgtgcggacatttcctctgtt
ggtacctcttttgctcgggccagtatcaaaagcacgaaactggacggcacatcctacttc
cgccgacaagagaagctactgcggatctctgtccgtcacatggtcaagtctcaggcattt
tattggacagtcttgagtctggtggccctgaataccatgtgtgttgccatcgtacatcat
aagcagcctgtgggactctccaattttctctactatgcagagttcctgttcttgggtttg
tttctctcagagatgtttttaaaaatgtacggcctgggacccagactctacttccactca
tccttcaactgctttgactgtggagtggttgttggcagtatatttgaagttatctggagc
gtctttagacctggtatgtcctttggaattagtgttctgcgagccctgagactcctgagg
atatttaaaataaccaagtactgggcctcactgagaaacctggtcgtgtctctgatgaac
tccatgaagtcgatcatcagcctgctgttcctcctcttcctctttatcgtcgtctttgct
ctgttgggaatgcagctatttggtggagggtttaattttaatgacggcacaccatcagca
aactttgacaccttcccctcagccattatgactgtcttccagatcctgactggtgaggac
tggaatgaggtgatgtacaatgggatccgatcgcaggggggtgtgagttctggcatgtgg
tcctccatatacttcattgtgctcacactctttggaaactacactctgcttaatgttttc
ttggctattgctgtggataacttggccaatgcacaagagttaacaaaggatgaacaggag
gcagaggaagcctttaatcagaagcatgccctacagaaagccaaggaggttagccccatg
tcagcacctaacatgcactcaacagataaagagaagaagaaaagacatgcaatgtccatt
tgggaacagaggaccagccagttgaggcgtcacaggcagatgtccagtcaagaggcactt
tacaaagatgaaatggaagacttgacgtctgaattccaccagaaggccaaacttgaggag
gacatcagtacgcggagtgaggaggaagaagcaggacgtgaagatccagaaagtggggca
cagcagacacaggaaggagacccagaaaagttgccagtcaataatcactgccagggcatt
gaagagaaaagaagcccttcaccaacgtctcctgtagagaaggaatccagacacattaac
tcctgcagcctgacccaagatctgcctgggcaagaggatccactcgcaattgatgggtca
aaggacaaacgttgggaaaggcggagcagacacaggaaaatgagaggggaaggggaggca
aaggcatcttctcacaagaaaggcagcagattggctagccgggagaggagggggacagag
gaagatggacaggagggagaaaacagcaaagagaaaaaacacggccaagaagaggggaag
gaaacaacaagggagaggaggcgtgaaagagtaagcccagcactggacagtgcagcagct
cattctgatgccacagcaacagaaatgaactctccaggcactcaccatgatgaaactgat
gacaatgtgaaaaacaacaagctggtgctgctggattctagtgcccaggactctagtgaa
caagcgcagccaataaatcaacctgccaagccaaagaactccttcagtatggaggaatcc
agccacccgctcatccctaccgacagcgaaaaactctcagggcacacaaacttcatcatc
gaggtgacggacacccatggtccagttgattccattgttataccaggagagttctttgta
aagttgtcctctgccaagatgattgaccaaggtctgatactgcatgaggggtcatacttt
cgtgatctctggaacatcctagattttatcgtggtggttggtgctctgattgcctttgcc
ctgacgactaacaaaggaagagatataaaaaccatcaagtccctgagagtactacgggtc
cttcggccactgaagaccatcaagcggctaccaaaactaaaggctgtatttgactgcgtt
gtgacatccctgaagaatgtcttcaacattttgattgtctacaagcttttcatgttcatc
tttgccgtcatcgctgtgcagctgtttaaagggaagttctactactgtaccgaccgctcc
aaggacctccagaaagactgtgtaggacgctttgtggaccatgagaaaagcaagatcaca
gtggaggaacgggaatggaaaaggcatgactttcactacgatagtattatctgggccttg
ttgacactgtttacagtctccactggagaaggctggccacaggtactgcagcattcggtg
gacgtgacagaagaggaccgcggccccagtcctggaaaccggatggagatgtctattttt
tatgtgatctactttgtggtctttccttttttcttcgtcaatatctttgtggctctgatc
attatcacattccaggaacagggagataaaatgatggaagaatgcagcctggagaagaat
gagagggcctgcattgactttgcaattagtgccaagccgttgacccgctacatgcctcag
aatagacacacataccagtacagggtgtggcactttgtggtctctccctcctttgagtac
accatcttgaccatgattgcgctaaacaccgtggtcctcatgatgaagtactattctgct
ccaacagcctacgacttggtactgaagtatttgaatattgccttcacggtgcttttctca
ttggagtgcatattgaaaatcattgcatttggcttcttgaattactttcgggacacctgg
aacatatttgatttcatcacagttgtaggcagcatcactgagattatcctctcagacagc
aagacattcaatatgagtttcctgaagttgttccgtgctgcccgtctcatcaagctgcta
cgacagggatataccattcgcatcctgctgtggacttttgtacagtcttttaaggccctt
ccatatgtttgcctgttgattgcaatgctctttttcatatatgcaatcattggaatgcag
gtatttgggaatataaaattgaatgaagaaactcagatcaatcgccataacaacttcaga
actttcttcagctcccttatgcttcttttccggagtgccacgggtgaggcctggcaagag
atcatgctttcttgtttgagtgggaaaaaatgtgaaatcgacacatcggccaccaatggg
acagatgaaaacgtggagagctgcggcacagacctggcatatttttactttgtatccttc
atatttctttgttcctttttgatgttgaatctgtttgtggctgtgattatggataacttt
gaatacttaacccgggactcctccatcctgggaccccatcacttggacgagtttgttcgt
atctgggctgagtatgacaaagctgcctgtggcaagattcactataaggacatgtacaaa
ttagtgcgagcgatttcgcctcctctgggtttagggaagaactgcccctacagagtggca
tgcaagaggctggttctgatgaatatgcctgttgatgaagatatgactgtgcatttcacc
tccaccttaatgggtttgatcagaacagccctggacatcaaaattgcaaaaggaggtgct
gacagacagcagttggactctgagctccagaaggaaatcctgcttatttggcctcatatt
tcacaaagaatgctggacctcttggtgccaatacataaagcatctgatttaacgattggc
aagatctatgctgcaatgatgataatggactactacaagcaaagcaaggctaaaaaacaa
agacaacagctggaggaacagaaactagcaccaatgtttcagcggatggatgcctcctcc
ttgcctcaggagatcatctccagtgccaaaactctaccttaccttcaccaaaacacaggg
ccaggcctaggcagtctaagcacatttgtgccattgagtcccctctccccccaggagatg
ttccagcccttacgtctgatagccctggagaaaggaagacctgaggacccccataggaat
atgactccagaaccagagaggaaggagttaaagagggtgccttattctagccgtggactg
tcctacctaccaattgaaactcatggacgagtcagctccatgagggcctcttctatgcca
tggctggcaatagagcctcaggtggtgacagatgccattgcgatgaggcgttccttctcc
accattggtgaccagcgggttaatggatcatggttggatgagtactcattggagcgagcc
agtccagatgaactatgcaaagagcatcgccggagttgtcggtcttcattgaggttgtct
ggccaacatttgaatatagactcaggtctccgacctgacacccaccattctgcagagcaa
gagagagggagatccagggagaggaaacacctgttgtcccctgatgtatcgcggtgcaac
tctgaggaaagacgacagctgccccatcatcagtcccgggagcgcaggcactcaaggtcc
ccaagtgaagggagatcgcagactccacaacgacagggaatggatttagagagcgagagc
ccagctgcttctacatccgataccagcaccccgaggcgtgggcgtcgtcagcttccacag
acccccttaaagccaaggccccacatcttatactcacccgtggtgcggcgatcgatgaat
acttcccctcccctgaatggcgttgcagcaaggaccaaggagcagccccccaagactgcc
aaaactgatcaaagtgaggtttctcagaatgagtcttccctcccagcccaaagcagcatt
ggtggcagccttggatccaccccgcataactacatctcagaccccttcctggctctccag
ggggacatcaagtgccccagcacgaccactactgatggggagctcacttttgaggctgcc
ttagcaacaagttttggaaggtccaatacaattggctctgcccctcccctcaggcactcc
tggcaagtgcccaatgggcatttccgggcacggctgtcacagctgggatcatcaaccgca
gcgtgtgacttagtcagcgacacagatgaagatgaccggtgttag

DBGET integrated database retrieval system