KEGG   Latimeria chalumnae (coelacanth): 102362720
Entry
102362720         CDS       T02913                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04370  VEGF signaling pathway
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102362720 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102362720 (CASP9)
   04115 p53 signaling pathway
    102362720 (CASP9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102362720 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcm01009]
    102362720 (CASP9)
   01002 Peptidases and inhibitors [BR:lcm01002]
    102362720 (CASP9)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102362720 (CASP9)
Protein phosphatases and associated proteins [BR:lcm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102362720 (CASP9)
Peptidases and inhibitors [BR:lcm01002]
 Cysteine peptidases
  Family C14: caspase family
   102362720 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 102362720
NCBI-ProteinID: XP_014353607
LinkDB
Position
Un
AA seq 439 aa
MDDRQRKILQRNRAMLVEKLDPSKIYDLLISKDVFTQDMIEEIKAAGPRRDQARQLVTDL
QTRGSQAFSIFLECLKETEQRNLADLLREGLHFQPAGPINIKPIKIPQIINKHPDQGRLS
SEFNDPRRNQSPTHVEARIQVPVQCSDIETLDSGGTRSRRNSGKEYKMDSSPCGYCLIIN
NVEFADGTRLNCRNGSDIDSTRLQKRFESFDFIVETCRNVTQKEMDEKLISMARKDHSQF
DCFVLVILSHGNESQHIQFPGAIYTTDGALTPVQQIVNYFNGSQCQTLRGKPKLFFLQAC
GGGKQHSNNYFRRLKGSCTPCCQSKYSEKGSLLVQHESDGSRASDFQSSNLFLVLCSSAG
YVSWRDRKVGSWYVEVLDKVFEKYGHDEDLLSLLVLVTDQVSQNSARGVFKQIPGCFNFL
RKRLFFRVKKADSRTVLLR
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggatgacagacagcgaaaaatccttcagcgaaaccgggctatgctcgttgaaaagcta
gatccatccaaaatctacgatttgttgatttcaaaggatgtcttcactcaggatatgatt
gaagaaattaaggcagcaggtcctcgaagagaccaggccaggcagctggtgacagacctg
cagactcgtgggagccaggctttttcaatatttttggagtgtctgaaagaaactgaacag
aggaatctggcagacctccttcgtgaggggctccacttccaaccagcaggccccattaac
atcaaaccaattaagattccacagatcataaacaaacacccagaccaaggtcgtctttcc
tctgaatttaatgaccctcggagaaatcaaagtcccacacatgtggaggcaagaattcag
gttccagtgcagtgttcagatattgaaaccttagacagtggcggcacgagatccagacgg
aatagcggtaaagaatacaaaatggattccagcccgtgcggttattgcttgatcataaac
aatgtggagtttgctgacggcactagactgaattgtcgaaacggttccgatattgactct
acaagactgcagaagcgattcgagtcgtttgatttcattgttgagacgtgtcggaatgta
acccagaaggaaatggatgaaaagttgatatcgatggcccgcaaggaccacagccaattc
gactgctttgttttggtcattctgtcacacggtaatgagagccagcacattcagttccca
ggagcgatctacaccacagatggggctttaactccagtgcagcagattgtcaactatttt
aatggctcccagtgccagactttgcgtggcaagccaaaacttttctttctacaagcttgt
gggggaggtaagcagcattctaacaattacttcagaagactgaaagggagttgcacccct
tgctgccagagcaaatacagcgagaaggggtcactgctagtccaacatgagtctgatggc
tcccgggcctcggattttcaatcctccaacctgtttcttgtcctgtgttcatctgcaggt
tatgtgtcctggagggatcgaaaagtgggatcctggtatgtggaagtcctggataaggtt
tttgaaaagtacggtcatgatgaagacctgctgtctttacttgtcttggtgacggaccag
gtgtcccagaattcagctagaggagtcttcaagcagattccaggctgtttcaacttcctg
cggaagcgccttttcttccgtgtgaagaaggcggactccagaactgtgctgcttagatga

DBGET integrated database retrieval system