KEGG   Latimeria chalumnae (coelacanth): 102363016Help
Entry
102363016         CDS       T02913                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D-like
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102363016
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102363016
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102363016
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   102363016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Tyrosinase
Motif
Other DBs
NCBI-GeneID: 102363016
NCBI-ProteinID: XP_006012677
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
PENLLYYNPDDESKIMISDFGLSKMEGTGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWS
IGVIAYILLCGYPPFYDENDSRLFEQILKAEYEFDSPYWDDISESAKDFISRLMEKDPSK
RYTCEQALRHPWIAGDTALCKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGS
SQEGSSASVHNNPTSPSTDGTTRKDCLSPITPCSLPSAVSSPSSALSPVGAEQRPRPTTI
TTVQTGNK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ccagaaaacctgttgtattacaaccccgatgacgaatccaagatcatgattagtgatttt
ggtttgtccaaaatggaaggaactggagatgtcatgtcgacagcatgtgggacaccaggt
tatgtagctcctgaagtgctcgcccagaaaccttacagcaaagcagtggactgttggtcc
attggggtcattgcatacattctgctttgtggttatcctccgttctatgatgaaaacgac
tccagactctttgaacagatcctcaaggcagagtatgagtttgattctccttactgggat
gacatctcggagtccgccaaagatttcattagtcgtttgatggagaaggaccctagtaaa
agatatacgtgtgaacaggctttgcgacatccatggattgctggagatactgccctatgt
aagaacattcatgagtccgtcagtgcacagattagaaaaaattttgcaaagagcaaatgg
aggcaagcgtttaatgccacagctgtcgtcagacacatgagaaaattacaccttggtagc
agtcaggaagggtccagtgcaagcgtgcacaacaaccctaccagcccatcaacagatgga
acaaccaggaaagactgtttgtcccccatcacaccctgtagtttaccctctgcagtttcc
tctccttcctctgccctatcccctgtaggagcagagcagagaccaaggcccaccacaata
accacagtgcagactggaaacaagtga

DBGET integrated database retrieval system