KEGG   Latimeria chalumnae (coelacanth): 102363139Help
Entry
102363139         CDS       T02913                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00511  Other glycan degradation
lcm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102363139 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102363139 (NEU2)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102363139 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 102363139
NCBI-ProteinID: XP_006003054
Ensembl: ENSLACG00000012725
LinkDB All DBs
Position
Un
AA seq 391 aa AA seqDB search
MWDRLPREVERLEMHSVLHLQQQPLFRKGEKAYRIPALLYLSQSSEFLAFAEERADLVDE
HAERLVVSRGRFDNDRFFAEWDSPERIASARLPDHRSMNPCPIYDRKTQTIFLFFIAVKG
TTSEAQQINAKRNATRLCYVTSMDMGKTWSSAMDLTEPAVGQTYSKWATFAIGPGHGVQL
QNSTESLVVPAYAYWIHSATERPKPKAFCFISHDHGKTWSIGHCIPNEYAVECQMASIEV
DGKQFLYCNARSLGSRVQAVSHDGGGKFEKGHRASNLVEPPHGCQGSIVGFPEPGPSQAA
KTWMLFSHPTDENKRRDLGIYLNQSPRDHTSWTAPIIIHHGPCAYSDLQYLGLNSEGYPA
FACLFECGKQLEYEEIAFVLFTLKLLFPALC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatcggcttccaagggaagtggagcggctggaaatgcattcagttttgcaccta
caacagcagcccttgtttcgtaaaggggagaaagcctatcgcatccctgctctgctctac
ctgtcccagagctccgagtttctggcatttgctgaggagagagcagacctagtcgacgaa
catgcggaaaggctcgtggttagcagaggcagattcgacaatgatagattttttgcggag
tgggatagtccagaaaggattgcttcggcgaggctgcctgatcacagatcaatgaatcca
tgtccgatctatgatagaaagacccaaaccattttcctcttcttcatcgctgtcaaaggc
accacttcagaagcgcagcaaatcaatgctaaacggaatgccacccggctctgctatgtc
accagcatggatatgggaaagacctggagctccgccatggatctaactgagccagcggtc
ggccaaacctacagcaaatgggcgacgtttgccattggaccgggtcacggagtacagctc
cagaacagtaccgagagccttgtggtcccagcctatgcttattggatccacagtgccact
gaacgccccaagcccaaagccttctgcttcatcagccacgatcacgggaagacgtggtcc
atagggcactgtatcccgaatgagtatgccgtggaatgccagatggcatccatcgaggtg
gatgggaaacaattcctttactgcaatgcccgaagcttggggtcaagggtgcaagcggtc
agccatgatggtggaggaaagtttgagaaagggcatcgagcgtcaaatctagttgagcct
ccccacggttgccagggcagcatcgttgggtttccggagccagggccatctcaagctgcc
aagacctggatgctcttctctcatcccaccgatgagaataagcgaagggatttggggatt
tacctgaaccaatcccctcgggatcatactagctggacagcgcccatcatcatccatcac
ggcccctgtgcttactcggatctgcagtacctcggcctgaactctgaagggtacccagcg
ttcgcctgcttatttgagtgcgggaagcaattggagtatgaagagatagcctttgtcttg
tttaccctcaagctcttgtttcctgctttgtgttag

DBGET integrated database retrieval system