KEGG   Latimeria chalumnae (coelacanth): 102363290
Entry
102363290         CDS       T02913                                 

Gene name
CCNE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04110  Cell cycle
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102363290 (CCNE2)
   04114 Oocyte meiosis
    102363290 (CCNE2)
   04115 p53 signaling pathway
    102363290 (CCNE2)
   04218 Cellular senescence
    102363290 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102363290 (CCNE2)
   03036 Chromosome and associated proteins [BR:lcm03036]
    102363290 (CCNE2)
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102363290 (CCNE2)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102363290 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102363290
NCBI-ProteinID: XP_014354300
Ensembl: ENSLACG00000001926
LinkDB
Position
Un
AA seq 287 aa
MSRRSGRLQEKNAKIDTQKLQIEVKRKRSSEECIKTKDKKQLNKKIQRFEIQNCWAPNLS
GGISPCVLIETPHKEIKYPDDVSRFRQYRFTNLFLKSSPLPFLSWGNSEDVWSNMLKKEI
KYVHEKHFFLLHPALKPHMRSILLDWLLEVCEVHTLHRETFYLAQDFFDRFMFTQTNINK
NQVQLIGITSLFIAAKLEEIYPPKLHEFAYITDGACTEEDILDMELIILKVCCRIWFSCQ
DSLLDLCILDDESLDYQYGVLAAAALYHFTSFEVVLKASVLEAVEEV
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtcaaggcgcagtggtcgattacaagaaaaaaatgcaaaaatagatacgcagaagctc
caaattgaagttaaaagaaaaagaagctctgaggaatgcatcaaaacaaaagacaaaaag
cagctgaacaagaagatccaacgctttgagatacagaactgctgggcacctaatttgtct
ggaggaattagcccttgtgtcctcatagaaactcctcacaaagaaataaagtacccagat
gatgtttccaggttcagacagtacaggtttacaaacctcttcttaaagtcttcacctttg
ccttttctcagttggggaaattcggaagatgtctggtcaaacatgttgaaaaaagagatc
aagtatgttcatgaaaaacacttcttcctgctgcacccagccctgaagccgcatatgagg
tcaattctacttgattggctcttagaggtttgtgaagttcatacccttcatagggaaacc
ttctacctagctcaagatttctttgacagattcatgtttacgcaaaccaatattaacaaa
aaccaggtgcaactaatagggattacctcactcttcattgctgccaaactagaggaaatc
tatcctccaaaactgcatgagtttgcctacatcacagatggtgcttgtacagaagaggac
atccttgatatggagcttattattttaaaggtatgctgtaggatatggttttcatgtcag
gattctcttttggatttgtgtatacttgatgatgaatcgctggattaccagtatggggta
ttagctgctgctgctctttatcattttacttcatttgaagtagttctcaaagcatcagtt
ctagaggctgtggaagaggtgtag

KEGG   Latimeria chalumnae (coelacanth): 102366176
Entry
102366176         CDS       T02913                                 

Gene name
CCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04110  Cell cycle
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102366176 (CCNE1)
   04114 Oocyte meiosis
    102366176 (CCNE1)
   04115 p53 signaling pathway
    102366176 (CCNE1)
   04218 Cellular senescence
    102366176 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102366176 (CCNE1)
   03036 Chromosome and associated proteins [BR:lcm03036]
    102366176 (CCNE1)
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102366176 (CCNE1)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102366176 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102366176
NCBI-ProteinID: XP_005997071
Ensembl: ENSLACG00000002147
LinkDB
Position
Un
AA seq 417 aa
MPRKSDQAGNKATKAEESSDLSTHPRKRKANVAICLQDPDEEIAEIQATKKREHEIEPFW
NSNPDLSSPSRLLPTPDKEVDEVVPIDSCSHAHSESRSMWLFNRSSPLPVLSWASQNDVW
KNMIRKEEMYVKDKRFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRFM
GTQQNVVKTRLQLIGISALFIAAKLEEIYPPKLHQFAHVTDGACTEEEINDMELVIMKAL
KWSLSPLTLVAWLNVYLQIAYLNLNCNEQEVLLPQYPQETFVQVIELIDLCVLDIGCLEF
AYSVLAASALCHFSSYELMQRVSGYNWSDIGECMKWMSPFLLAIKEVGSSKLKFFKAIAQ
EDMHNIQTHSNYLDLLDKAEMKRPLLAEENCNSPVPSGVLTPPHSSKKQNLGLYASK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgccaaggaaaagtgatcaggcaggaaacaaagctacaaaagctgaagaaagcagtgac
ttatctacacaccctcggaaaaggaaagcaaacgttgctatttgtttacaggacccagac
gaagaaattgcagaaatacaagcgacaaagaaaagagagcatgaaatagagccattctgg
aacagcaacccagacctttcaagtccaagcagacttcttcccactcctgataaagaagta
gatgaagtggtcccgatagactcttgttcgcacgcacacagcgaatctagaagcatgtgg
ctattcaatcgatcctctccattgccagtattgagttgggcaagccagaatgatgtgtgg
aagaacatgattaggaaagaagaaatgtacgttaaagacaaacgttttatgcaaaggcat
ccacttctacaacctaaaatgagagccatacttctagactggttgatggaggtatgtgaa
gtctacaagctacatagagagaccttttatttggcacaagatttctttgatcggtttatg
ggaacacaacaaaatgttgtgaagacacggctacaacttatagggatttcagctttattt
atagctgcaaagcttgaggaaatctatccacctaagctacatcagtttgcccatgttaca
gatggggcttgcacagaagaggaaattaatgatatggaattggttataatgaaggctctt
aagtggagtttgagtcctttgactcttgtagcttggctaaatgtctacctgcaaattgca
tatttaaacttaaattgcaatgaacaagaggttttgctgccacagtatccccaggagact
tttgtacaagtaatagagttgatagatctctgcgtgctagacattgggtgtttggaattt
gcatacagtgtgctggctgcttcagctttgtgccatttctcatcctatgagttgatgcag
agagtttcaggttacaattggagtgatattggggagtgtatgaagtggatgagtcccttt
cttctggctataaaggaagtaggaagttccaaactgaagttcttcaaagcaatagctcaa
gaggacatgcataatatacagacccattcaaactacttggatttgctggacaaagcagag
atgaaacggcctttactggcagaagaaaactgtaattctccagtaccttcaggtgttctc
acgccaccgcatagtagcaagaaacagaacctgggactgtatgcaagcaagtga

DBGET integrated database retrieval system