KEGG   Latimeria chalumnae (coelacanth): 102363451
Entry
102363451         CDS       T02913                                 

Gene name
RPRM
Definition
(RefSeq) reprimo, TP53 dependent G2 arrest mediator candidate
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102363451 (RPRM)
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 102363451
NCBI-ProteinID: XP_006010568
LinkDB
Position
Un
AA seq 108 aa
MNSTIINQTDTGLLFSNRSDSLETVFRCCNQTSVVTDDGFVVTAPDERSLYIMRVVQIAV
MCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVIVGPY
NT seq 327 nt   +upstreamnt  +downstreamnt
atgaattctacgatcatcaatcagacagacactggacttttgttttccaacaggagtgac
tccttggaaactgtttttagatgctgtaatcaaacctctgtggtgacagacgatggcttt
gtggtcacagccccagatgaaagaagtctctacattatgagagttgttcagatagctgtg
atgtgtgtgctttctcttaccgtggtcttcggtatcttctttttaggctgcaatctgctt
atcaaatcggaaggaatgattaattttttagtcaaggacaggagaccttccaaagaggtg
gaagcagtgattgttggtccttactag

KEGG   Latimeria chalumnae (coelacanth): 106702484
Entry
106702484         CDS       T02913                                 

Definition
(RefSeq) protein reprimo A-like
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106702484
SSDB
Motif
Pfam: Tmemb_9 SP_C-Propep
Other DBs
NCBI-GeneID: 106702484
NCBI-ProteinID: XP_014340458
Ensembl: ENSLACG00000019121
LinkDB
Position
Un
AA seq 97 aa
MNGTVLGRQADSLLGCCNFSSAVVWDERLGVSGADERSLYIMRVVQIAVLCVLSITVIFG
IFFLGCNLLLKSESMINLLVKERRPSNEVEAIIIGSY
NT seq 294 nt   +upstreamnt  +downstreamnt
atgaatgggaccgtgttggggaggcaggcagactctctgcttggctgctgtaacttctcc
agcgcggtggtttgggatgagagactgggggtgtcaggagcggacgaacggagtctctat
atcatgagggtggttcagatcgctgtcctctgtgtcctttccattactgtcatcttcggc
atctttttcttgggctgtaaccttctcctcaaatccgagagtatgatcaacctgctggtg
aaggaaaggagaccctccaacgaggtggaagcaattataatcgggtcatattga

DBGET integrated database retrieval system