KEGG   Latimeria chalumnae (coelacanth): 102363834Help
Entry
102363834         CDS       T02913                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00020  Citrate cycle (TCA cycle)
lcm00310  Lysine degradation
lcm00380  Tryptophan metabolism
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
Module
lcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lcm_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102363834 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    102363834 (OGDHL)
   00380 Tryptophan metabolism
    102363834 (OGDHL)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     102363834 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 102363834
NCBI-ProteinID: XP_005992475
Ensembl: ENSLACG00000010537
UniProt: H3AQQ2
LinkDB All DBs
Position
Un
AA seq 1017 aa AA seqDB search
MSPLRLAALKLKQYSVQLLAKRNVAMGILENSRSYTVPGKTESFLSGNNSNYVEEMYYAW
LENPKSVHKSWDVFFRNVNAGAPAGQAYQSPSSITNNVATLIKSQGLAQAPPKAEKLVED
HLAVQSLIRAYQIRGHHIAQLDPLGILDADLDSSVPSDLITTSDKLAFYGLNESDLDKKF
RLPLTTFIGGTETLLSLQEIIKRLEGVYCQHIGLEFMFINDGEQCQWIRQKFEMPDIMKF
TTKEKRLLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVLIPALKSIIDKSSEMGIESVI
MGMPHRGRLNVLANVFRMDLEEIFCQFDSKLEAADEGSGDVKYHLGMHHERINRVTNKNI
TLSLVANPSHLEAVDPVVQGKTKAEQFYRGDTEGKKVMSILLHGDAAFAGQGVVYETFHL
SDLPSYTTNGTIHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVFYV
CTVAAEWRNVFNKDVVVDLVCYRRSGHNEMDEPMFTQPLMYKQISSQTPVLKKYADKLIA
EGSVTLQEFEEEISAYDKICEEAFNRSKDEKVVHMKYWLDSPWPGFFTADGEPKTMTCSP
TGVSEKILTHIGNVASSVPMQGFKVHRGLSRILKGRAEMISNWAVDWALAEYMAFGSLLE
EGIHVRLSGQDVERGTFSHRHHVLHDQEVDKKTCIPMNHLWPNQAPYTVCNSSLSEYGVL
GFELGFAMASPNALICWEAQFGDFHNTAQCILDQFISSGQTKWVRQNGIVLLLPHGMEGM
GPEHSSARPERFLQMSNDDCDAYPEFTENYEVHQLYDCNWIVVNCSTPANYFHVLRRQIR
LPFRKPLVIFTPKSLLRHLNARSSFDEIITGTNFRRLIPEEGTAAQNPEEVKRLIFCAGK
IYYDLTKERADQDLEKEVAIARIEQISPFPFDLVKKETDKYCKADLVWCQEEHKNMGFYD
YIKPRFLTLLYHSRPIWYVGRDPAASPATGNKNTHTTEVRKCLDTVFNLQAFEGKKF
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctttaaggttagctgctttaaagctaaaacagtacagtgtacaactgttggca
aagcgcaatgtggctatggggattttggaaaatagtcggtcttatactgtacctggaaag
acagagagttttctaagtgggaataactcaaactatgttgaagaaatgtactatgcatgg
ctggaaaaccccaaaagtgttcataagtcttgggatgtgttttttcgcaatgtcaatgct
ggagctcctgctggtcaagcttaccaaagcccttcttcaatcactaacaatgtggcaact
ctgattaagagccaaggtctggcacaggcacctcccaaagcagagaagctggtagaggat
catttggctgtacagtctttgatccgagcatatcagatccgtggacatcacatagctcag
ttggatcccttaggaatcctggatgcagacttggattcatctgtgccatctgatttaatc
actaccagtgataagctggcattttacgggttgaatgagtctgacttggacaagaaattc
cggttgccattgaccactttcattggagggactgagacattgttatctttgcaggaaatc
attaaacggctggagggtgtttactgccaacatattggattagaattcatgtttataaat
gatggggaacagtgccagtggattaggcagaaatttgagatgcctgatattatgaaattc
accaccaaagagaaaaggttactgttggccaggctggttcggtccacaaggtttgaagac
tttctggctcggaaatggtcatcggagaaacgctttggtttagaagggtgtgaggtactg
attcctgctctcaagagcatcattgataaatccagtgaaatgggtattgaatctgtgatc
atgggtatgcctcacagaggaaggttaaatgtgttggcaaatgtctttagaatggattta
gaggaaatattttgccagtttgattcaaaacttgaggctgctgatgaggggtctggagat
gtgaaataccacctcggcatgcatcatgagagaatcaatcgagtaaccaacaagaacatc
acactctccctggtggcaaacccatctcatctggaagcagttgaccctgtggtacaagga
aagaccaaagcagaacagttttaccgtggagacacagagggaaagaaggtaatgtccatt
cttttacatggtgatgctgcctttgctgggcaaggtgtagtgtatgagacatttcatctc
agtgatcttccgtcatataccacaaatggtaccatccatatagtggttaataatcagatt
ggttttacaacagatccccgtatggcccgctcatctccttaccctactgatgttgcccgt
gttgtgaatgctcctattttccatgtgaatgctgatgatcctgaagctgtcttttatgtg
tgtactgtagctgctgaatggcggaatgtatttaataaggatgtggtagtggatctggtc
tgctatcgcagaagtggtcacaatgaaatggatgagcccatgtttactcagcccctgatg
tacaagcagatctctagtcagacgccagtactgaagaagtatgctgacaaacttattgct
gaggggtctgtaacactacaggagtttgaggaagaaatttcagcatatgacaagatctgt
gaagaagcatttaataggtcaaaggatgaaaaagttgttcatatgaagtactggttagat
tcaccttggccaggttttttcacagcagatggtgagccaaagactatgacctgttctcca
actggtgtgtctgaaaaaatcctgacacatattggcaatgtagctagctcagtgcctatg
caaggcttcaaagtccacagagggctgtctcgtattttaaaggggcgagctgaaatgata
agtaactgggctgttgattgggctttggcagaatacatggcatttggatccttgctagaa
gaaggcatacatgtacgtctgagtggacaggatgtggaaaggggaaccttcagtcatcgt
caccatgtgcttcatgatcaggaagtagacaagaagacttgtattcccatgaatcacctg
tggccaaatcaagcaccttatactgtgtgcaacagctctctctcagaatatggtgtctta
ggatttgagcttggctttgcaatggccagtcctaatgctttgatatgctgggaggcccag
tttggtgattttcataacactgctcaatgcattctagaccagttcatcagctcaggtcag
acaaagtgggttagacagaatggaatagtgctcctcctccctcatggcatggaggggatg
ggtccagagcactcttctgccagaccagagaggtttctacagatgagtaatgatgactgt
gatgcatacccagaatttactgagaactatgaggtgcaccagctgtatgattgtaactgg
attgtggtaaactgttcgacgcctgccaattacttccatgtgctgaggagacagattaga
ctaccattccgaaaaccgttggttatatttactccaaaatcactgctgagacacttgaat
gctaggtccagttttgatgagatcataacaggaacaaatttcagacgtttgattcctgaa
gaaggaactgcagctcagaacccagaagaagtgaaaaggttaattttctgtgcagggaaa
atatattatgacctcaccaaagaaagagcagaccaagacttagaaaaagaagtagctatt
gccagaattgagcagatttctccatttccctttgacttggtaaagaaagagacagacaaa
tattgtaaagctgaccttgtgtggtgccaagaagagcataaaaacatgggattttatgac
tacatcaagccccgctttctaaccttgctataccacagtcggccaatatggtatgtgggc
cgtgacccagcagcctcccctgccacaggtaacaagaacactcacacgacagaagttaga
aaatgcttggacacagtcttcaacttgcaagcttttgaaggaaagaagttttaa

DBGET integrated database retrieval system