KEGG   Latimeria chalumnae (coelacanth): 102363850
Entry
102363850         CDS       T02913                                 

Gene name
RFWD2
Definition
(RefSeq) ring finger and WD repeat domain 2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102363850 (RFWD2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102363850 (RFWD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lcm04121]
    102363850 (RFWD2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102363850 (RFWD2)
Ubiquitin system [BR:lcm04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102363850 (RFWD2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102363850 (RFWD2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_5 zf-RING_2 zf-C3HC4_3 zf-C3HC4_4 WD40_like zf_C2H2_10 zf-RING_10 Prok-RING_4 zf-rbx1 DZR zf-RING_4 zf-RING_11 zf-Nse
Other DBs
NCBI-GeneID: 102363850
NCBI-ProteinID: XP_005996897
Ensembl: ENSLACG00000011141
UniProt: H3ASM4
LinkDB
Position
Un
AA seq 702 aa
MSASRQQQQCPGQGSSGTAVPAAAPSSSSGAGRPGTSAGQAAVTAAAAASGSGVGLARVG
AGRAGSSSSSSSSSSQSGSRKRPLLTPLCNGLLNSYEDKSNDFVCPICFEMIEEAYMTKC
GHSFCSKCIRQSLEDSNRCPKCNYVVDNIDQLFPNFLVNELILKQKQRFEDKRLKLDHSN
GHKWQIFQDVLGTDQESLDLAKINQILELLVQKKKQLEAESQAAQLQILMEFLKEARRNK
REQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEIDQSQNLDSTVPQFEAPSPSHSIIDST
EYTQHPGFSGTSQGKRQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRIVNQL
DEFQECLAKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYE
YGTVIQDAVDIHYPVIEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVY
QEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPTSRY
HLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVNK
PHCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDK
DKKEDDTNEFVSAVCWRARPDGESNVLIAANSQGTIKVLELV
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgtcagcgagccgccagcagcagcagtgtcccgggcagggtagcagcgggacagcggtc
cccgcggccgcgccatcctccagctcgggggccggccggccggggacctcagctggacag
gcagcagtaaccgcggccgccgcagcctcaggttcgggtgtggggctggcccgggtggga
gcgggccgggccggtagcagtagcagtagtagctcctcatcctcgcagtcgggtagcagg
aagcggccgctgctgactccgctctgtaacgggctgctgaactcgtatgaggacaagagc
aacgatttcgtctgcccaatctgttttgagatgatcgaggaagcgtacatgacaaaatgt
gggcacagcttctgttcaaagtgtattcgacagagcctggaagacagtaacagatgtccc
aaatgtaattatgtggtagacaatatagatcagctcttccccaacttcttagtgaatgag
ctaatcttgaaacagaagcaaaggtttgaagacaaacgactcaaactggatcactctaat
gggcacaagtggcagatcttccaggatgtcctgggcactgaccaggaaagtttggacctg
gccaagataaaccagatactggaactgctagtgcagaaaaagaagcagctggaggcggaa
tcccaagctgcccaacttcagatcttgatggagttcctcaaagaggctagaagaaacaag
agagagcaactagagcagatccagaaggagctgagtgttttggaagaggatatcaagcgg
gtggaggaaatgagtggtttgtattcccctgtgagtgagatagatcagtcccagaacttg
gacagcactgtgcctcagtttgaagctccatctccctcacacagtattattgactctaca
gaatacacacagcatcctggattcagtggcacatcacagggtaagaggcagccgtggtac
aacagcacattggcatctagacggaaacggctaacagcacactttgaagacctggagcag
tgctatttctccacccggatgtctcgtatatcagatgacagcaggatagtgaaccagctg
gatgagtttcaggagtgcttggcaaaattcacgcgttacaattccgttcgacctctcgcc
acgctgtcctacgccagtgacctatacaatggctccagcatagtctctagtattgagttt
gaccgggattgcgattactttgctattgctggagtgaccaagaagatcaaagtgtacgaa
tacggtacagtgatccaggatgctgtggacattcactaccctgtcattgagatgacctgc
aactccaaaatcagctgtatcagctggagtagctaccacaagaacttgctggccagcagt
gactatgagggcacagtcatcctatgggatggtttcacgggtcagaggtcaaaggtctat
caggagcatgagaaaaggtgctggagtgtcgattttaacctgatggaccccaaacttcta
gcttcaggctctgatgatgctaaagtgaagttatggtcaaccaacctggacaactctgta
gccagtattgaagccaaggcaaatgtttgctgtgtcaagttcagccctacgtccaggtac
catcttgcattcggctgtgcagatcactgcgttcactactatgaccttcgcaacactaaa
cagcctatcatggttttcaaaggccatcggaaggccgtctcctatgcaaagtttgtcagt
ggagaagaaatcgtttctgcctccacagacagccaactaaagctgtggaacgtgaacaaa
cctcactgcctacggtctttcaagggtcacatcaacgagaagaattttgtggggctggca
tccaacggagattacattgcctgtggctctgaaaacaactccctttacttgtattacaag
ggtctttccaagacgctgctgacatttaaatttgacacagtgaagagtgtcctggacaaa
gacaagaaagaagatgacacaaatgagtttgtgagcgctgtgtgctggagggcccggccg
gatggggagtccaatgtgctaatagctgccaacagtcagggtacaatcaaggtactggag
ctggtatga

DBGET integrated database retrieval system