KEGG   Latimeria chalumnae (coelacanth): 102364066
Entry
102364066         CDS       T02913                                 

Gene name
CD82
Definition
(RefSeq) CD82 molecule
  KO
K06509  CD82 antigen
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102364066 (CD82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102364066 (CD82)
   04090 CD molecules [BR:lcm04090]
    102364066 (CD82)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102364066 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   102364066 (CD82)
  Exosomal proteins of colorectal cancer cells
   102364066 (CD82)
CD molecules [BR:lcm04090]
 Proteins
  102364066 (CD82)
SSDB
Motif
Pfam: Tetraspanin DUF1310
Other DBs
NCBI-GeneID: 102364066
NCBI-ProteinID: XP_005986976
Ensembl: ENSLACG00000017907
LinkDB
Position
Un
AA seq 264 aa
MVFQGAKMSTGCIKATKYFLFLFNLLFFILGAVILGFGLWIQLDKTSFIAVLESSSVALK
TGSFILIGVGSVTMLMGFLGCIGAVNEIKCLLGLYFTCLLLILIAQIAAGVLIYVQRDML
KEEMSSIVHKVILNYNPDDGESDNAEQTWDYIQKHLRCCGWNGPQNWTQNVILNSTKNFY
PCSCGNATAGVQKELGFCETDEYEEWPVYSRGCMESVEEWLLSNIGIILGVCIGVAVVEL
LGMILSMYLCKSVQTEDYTKVPKY
NT seq 795 nt   +upstreamnt  +downstreamnt
atggtattccagggagcaaagatgtcaaccgggtgcataaaggctacaaaatacttcctg
tttttgttcaacctcctgttttttatccttggagctgtaatcttgggctttggactatgg
atccagctggataagaccagtttcattgcagttttggaatcatcttctgtagcgttgaaa
actggctccttcatcctcatcggggttggctctgtcaccatgctgatgggatttctgggc
tgcattggggctgttaatgaaatcaaatgccttctgggactgtatttcacatgtttgctg
ttgattctaatcgcacagattgctgcaggagttctcatctatgtccagagggatatgctg
aaagaggaaatgtccagtattgttcacaaagtgatcctgaattataatccagatgatggt
gagagtgacaatgcagagcaaacctgggactacattcagaaacatctccgctgttgtggg
tggaatggccctcagaactggacccagaatgtcattctgaacagtaccaagaacttctac
ccttgttcatgtggaaacgccacggctggtgtgcagaaggagctgggcttctgtgagacg
gatgaatatgaggagtggcccgtctacagcaggggttgtatggagagcgtagaggaatgg
ttactcagtaatattgggatcattcttggtgtttgcatcggagttgctgttgttgagttg
ctgggaatgatcctgtccatgtacctgtgcaagagtgtccagacagaggactacaccaaa
gtacccaaatactga

DBGET integrated database retrieval system