KEGG   Latimeria chalumnae (coelacanth): 102364155
Entry
102364155         CDS       T02913                                 

Gene name
TP73
Definition
(RefSeq) tumor protein p73
  KO
K10148  tumor protein p73
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102364155 (TP73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcm03000]
    102364155 (TP73)
Transcription factors [BR:lcm03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102364155 (TP73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 102364155
NCBI-ProteinID: XP_005986096
Ensembl: ENSLACG00000019068
LinkDB
Position
Un
AA seq 657 aa
MKDWRWIPLQKVISPSLDYLTTKMAQSSPDDEGTTFEHLWSTLEPDSTYFDLPQSNHSGG
SEGVTSLSSNQAEVSMDIFQMRGMNESVMSQFNMLNNTMDQSIGSRAASTSPYSSEHPLN
VPTHSPYSQPNSTFDAMSPAPAIPSNTDYPGPHNFEVTFQQSSTAKSATWTYSPLLKKLY
CQIAKTCPIQIKVSTPPPPASVIRAMPVYKKAEHVTEVVKRCPNHELGRDFNDSQSAPAS
HLIRVEGNNLAQYVDDPVSGRQSVFVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPIV
IIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHFREQQAMNESAAKNGNGNKRTFKQ
NPQGIPGLGVSIKKRKHGEEEIYYVPVRGRENFEILMKIKESLELVELVPQQLVESYRQQ
QQQLLQRQNHWQPPTSYGPVLSPMNKVHGGMNKLPSVNQLVGQPSQHNNSVSNLGPMGPG
MLNSHHMQPNGDINGGHSSQSMVSTSHCTPPPPYNPDPSFVSFLTSLGCPNCIEYFTSQG
LQNMYQLQNLSMEDLGALKIPDQYRMIIWRGLQELKQSQEYTPQQLIRSSSNTSTIAIGA
SGELQRQRVMEAVHFRVRHTITIPNRTDDWADFGFDVPDCKARKQSIKEEFTDSELN
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgaaggactggcgctggatcccgctgcaaaaggtgatcagtccgtcactggattacctc
accaccaagatggcccagtcttctccggacgatgaaggaactacgtttgaacatctctgg
agtactctagagccagacagcacgtacttcgatttaccccaatccaaccactcgggtggc
agcgagggagtcacaagcctgtcctcaaaccaagctgaggtcagcatggacatcttccaa
atgagggggatgaacgagtctgtcatgtctcagtttaatatgctcaacaacaccatggat
cagagtatcggcagcagagcggcctccaccagcccctacagctccgagcaccccttgaac
gtcccaacgcattcgccgtactcccagcccaactcgacgttcgatgccatgtcgcccgcg
ccggctatcccatccaacaccgactaccctggacctcacaactttgaggtgaccttccaa
cagtctagcaccgccaagtcagctacctggacatattctccactgctgaaaaaattatac
tgtcagattgcaaagacgtgccccatccagatcaaggtctccacaccgcctcctcctgcc
agcgtgattagggcgatgccagtctacaagaaggcagagcacgtgactgaagtggtcaag
cgttgcccaaaccatgaacttggacgagacttcaacgacagtcaatcagccccggcgagc
catctgattcgtgtggaaggcaacaacctggcccagtatgtggacgaccccgtcagtggg
agacagagcgtcttcgtaccgtacgagccgcctcaggttgggacggagtttacgacaatt
ctctataactttatgtgcaacagtagctgtgtcggaggaatgaacagacgccctattgtg
atcatcattacactggagacaagggatggccaggttctgggtcgaaggtcgtttgaaggt
cgcatctgtgcctgcccaggcagagaccgaaaagcagatgaagaccatttccgggagcag
caggccatgaacgaaagtgcggcaaaaaacggcaatggcaacaaacgcacgttcaaacag
aacccccagggcattcctggattaggggtcagcatcaagaagaggaaacatggcgaggag
gaaatctattacgtgcctgtccgaggccgggagaattttgagatcttgatgaagattaag
gaaagcctggagctagtagaactggtacctcagcagctggtcgagtcctacaggcagcaa
cagcagcagctcctccagagacagaatcactggcagcccccgacctcctatggcccagtg
ctttcgccaatgaataaagtccatggaggaatgaacaaactgccgtctgtcaatcagtta
gtgggccagccatcccaacacaacaattcagtgtccaacctggggcctatgggccctgga
atgctcaacagccatcatatgcagcccaatggtgacataaatggggggcattcttctcaa
tctatggtgtcaacatcacactgtactcctccgccaccctacaaccctgacccaagcttc
gtcagttttttaaccagcctggggtgtccaaactgcatcgagtatttcacatcacaaggg
ttacagaatatgtatcagctgcagaacctttccatggaggatcttggggcactgaagatc
ccagatcagtaccgcatgatcatttggaggggtctgcaagaactgaagcaaagccaagaa
tacaccccccagcaactgatccgctccagcagcaacacctccaccatagccatcggcgcc
tccggcgagcttcagcgccagcgtgtgatggaggctgtgcacttccgcgttcggcacacc
atcaccatccccaaccgcacggacgactgggcagacttcggcttcgacgtcccggactgc
aaagctcgcaaacagtccataaaggaagaattcacagacagcgagctcaactaa

DBGET integrated database retrieval system