KEGG   Latimeria chalumnae (coelacanth): 102364515
Entry
102364515         CDS       T02913                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102364515
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102364515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcm04052]
    102364515
Cytokines and growth factors [BR:lcm04052]
 Growth factors
  Growth factors (RTK binding)
   102364515
SSDB
Motif
Pfam: SCF DUF5362 DUF3671
Other DBs
NCBI-GeneID: 102364515
NCBI-ProteinID: XP_006011297
Ensembl: ENSLACG00000003740
UniProt: H3A3I3
LinkDB
Position
Un
AA seq 221 aa
MTDPPECWLYLMVPKVSETLQSLLEKFNETSSNYSIIRGLRMVLDEIRSCLSSEIKESMT
KYNCLYLEKKLLAKGYFDQVQSVLTIFKNFRGSPKCNLSCLHTAEVSETEPSTESSHNTS
DPILDHSNATCDFVNCLSHIEHHENSSTNQQFAEVLEEIKIPLICLAIVPVAGILFGISL
WKRNQRIKRQQRSQNEESIENGKNNEQQSMLHLEGNRNAEV
NT seq 666 nt   +upstreamnt  +downstreamnt
atgacagatccgcctgaatgttggctgtatctaatggtgcctaaagtatctgaaaccctg
cagagtctccttgaaaaatttaatgagacttcaagcaactattcaatcatccgtggactg
agaatggtgcttgatgaaattcgtagttgcttatcgtcagagattaaggaatccatgact
aaatataattgcctctacttagagaagaagttattggcaaaaggctactttgatcaagtt
caaagtgttcttaccatttttaagaatttcagaggttcacccaagtgcaatctttcgtgt
ttacacacagcagaggtgtcagagacagagccaagtacagagtccagtcataataccagt
gaccctattctggaccattccaacgcaacttgtgattttgtgaactgtctttcacatata
gaacaccatgaaaatagttcaaccaaccaacagtttgcagaggtattggaagaaattaaa
attccactgatatgtctggctatagttcctgttgctggcattttgttcggaatctcacta
tggaagaggaatcaaagaataaaaagacagcagagaagtcaaaatgaagagagtattgaa
aatgggaagaataatgaacaacagagtatgctacatctagaagggaatagaaatgcagaa
gtgtag

DBGET integrated database retrieval system