KEGG   Latimeria chalumnae (coelacanth): 102364653
Entry
102364653         CDS       T02913                                 

Gene name
CDK1
Definition
(RefSeq) cyclin dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04110  Cell cycle
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04540  Gap junction
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102364653 (CDK1)
   04114 Oocyte meiosis
    102364653 (CDK1)
   04115 p53 signaling pathway
    102364653 (CDK1)
   04218 Cellular senescence
    102364653 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102364653 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102364653 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102364653 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102364653 (CDK1)
   03036 Chromosome and associated proteins [BR:lcm03036]
    102364653 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102364653 (CDK1)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102364653 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     102364653 (CDK1)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102364653 (CDK1)
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102364653 (CDK1)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102364653 (CDK1)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102364653 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Kdo Seadorna_VP7
Other DBs
NCBI-GeneID: 102364653
NCBI-ProteinID: XP_006007727
Ensembl: ENSLACG00000022150
UniProt: M3XH50
LinkDB
Position
Un
AA seq 302 aa
MDDYVKIEKIGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVPSTAIREISLLKELQH
PNVVCLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILQGILFCH
ARRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRAPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNNDVWPDVESLPDYKNT
FPKWKAGSLSAHVKHLDEDGIYLLSKMLIYDPAKRITAKQALNHSYFDDLDKSNLPDNQI
KK
NT seq 909 nt   +upstreamnt  +downstreamnt
atggatgattatgtgaagatagagaaaattggtgaagggacttatggtgttgtgtacaaa
ggtcgccataaatccactgggcaagtggtggctatgaagaaaatcagactagaaagtgag
gaggaaggtgttcccagcactgccattagagaaatttctttgttaaaagagctacaacat
cctaatgtagtttgcctgcaagatgttcttatgcaagattcaagactgtatcttatcttt
gaatttctttctatggacctcaagaaatacttggattctataccttctggccagtatatg
gatccaatgttagttaagagttacttgtaccaaatattgcaaggcattcttttttgtcac
gccagacgagttctgcacagagacttaaagcctcagaacctcttgatagacaataaagga
gtcattaaactagcagattttggacttgcacgagcctttggcattcctgtcagagtttac
acacatgaggtcgtgacactatggtatagagctccagaggtactgctgggttctgctcgt
tactccacccctgtagatatatggagtattggcacaatatttgcagaactagctaccaag
aaaccactctttcatggagactctgaaattgaccaattattccgtatcttcaggacacta
ggaacacctaacaatgatgtgtggccagatgtggagtcactaccagattataaaaacact
ttccctaaatggaaagcagggagcctatctgcacatgtaaaacatttggatgaagatgga
atttatctgttatcgaaaatgttgatttatgatcctgccaagagaattacagctaagcaa
gctttgaaccattcttattttgatgatttggataaatccaaccttccagacaaccagatc
aagaaataa

DBGET integrated database retrieval system