KEGG   Latimeria chalumnae (coelacanth): 102364718Help
Entry
102364718         CDS       T02913                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00010  Glycolysis / Gluconeogenesis
lcm00052  Galactose metabolism
lcm00500  Starch and sucrose metabolism
lcm00520  Amino sugar and nucleotide sugar metabolism
lcm00524  Neomycin, kanamycin and gentamicin biosynthesis
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
lcm04910  Insulin signaling pathway
Module
lcm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102364718 (GCK)
   00052 Galactose metabolism
    102364718 (GCK)
   00500 Starch and sucrose metabolism
    102364718 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    102364718 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102364718 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102364718 (GCK)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     102364718 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102364718
NCBI-ProteinID: XP_014344414
Ensembl: ENSLACG00000012891
LinkDB All DBs
Position
Un
AA seq 466 aa AA seqDB search
MLNRICDQCCVLYYTQVKLILSDFQLQKKELEEVMRRMQQEMERGLRLKTHDEASVKMLP
TYVRSTPDGSEVGDFLALDLGGTNFRVMLVKVGEDEKGKWKVETKHQMYCIPGDTMTGTA
EMLFDYIAQCISDFLDKHNMKEKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIRRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTGCNACYMEEIR
NVDLVEGEEGRMCVNTEWGAFGDSGELEEFRLEYDRMVDEMSLNPGQQLFEKIISGKYMG
ELVRLVLLKLVNENLLFNGEASGILKTRGSFETRFISQIESDSGDLKQTYNILTTLGLLP
SKLDCEIVRLVSESVSTRAALVCAAGLAGVINRMRENRSQESLKITVGVDGSVYKLHPLF
KHKFHAMVQELTPRCNITFIQSEEGSGRGAALVSAVARKMASMLCH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaccgtatttgtgatcagtgctgtgttctgtattacacccaggtaaagctgatt
ttatctgacttccagctgcagaaaaaggagctggaggaagtgatgcggagaatgcaacag
gaaatggagagggggctgaggctcaagacacatgatgaggccagtgtcaaaatgttaccc
acctatgtgcgctccactcccgatggatcagaggtgggagacttccttgctctggacctt
ggaggcaccaatttccgagtaatgcttgtgaaagtaggtgaagatgagaaggggaagtgg
aaggtggaaaccaagcatcagatgtactgcattccaggagacaccatgactggaactgca
gagatgttgtttgattatattgctcaatgcatctctgacttcttggacaaacacaacatg
aaagaaaagaagcttccattgggattcacattttcctttcctgtcaggcatgaagatatt
gacaagggtattcttctcaactggacaaaagggttcaaagcctcaggggcggagggtaat
aatgtcgtaggactcctacgtgatgctatcagacgacgaggtgattttgaaatggatgta
gttgccatggtgaatgatactgttgctacgatgatttcctgttactatgaagacagaagc
tgtgaagttggaatgatagtcggtaccggctgcaatgcgtgctacatggaggagatcaga
aacgtggacctggtagaaggagaagaagggagaatgtgtgtgaacacagagtggggagcc
tttggagactcaggagagcttgaggaattccggctggagtatgaccgcatggtggatgag
atgtcactcaacccaggccaacagctgtttgagaagatcattagtgggaaatacatgggg
gaactggtcagactggtgttactgaagctggtgaatgaaaacctattgtttaacggagag
gcttcaggcattctgaaaacacgaggcagctttgagaccagattcatttctcagattgaa
agtgattctggtgatctgaagcagacctataatatcctgacaaccctaggattgctgccc
tccaagttggactgcgagattgtgcgtctagtgtctgagagtgtctccacgcgggctgcc
ctcgtgtgcgcagcggggctggcaggggtcatcaatcggatgcgggaaaaccgaagccag
gagagcctgaagatcacggtcggcgtggatggatccgtctacaagctacaccctctgttt
aaacacaagttccacgccatggtgcaagagctgacaccgcgctgcaacatcacctttatc
cagtctgaggaaggcagcggcagaggggcggcactcgtctccgcagtggcacgcaagatg
gcctccatgctctgccactga

DBGET integrated database retrieval system