KEGG   Latimeria chalumnae (coelacanth): 102364869Help
Entry
102364869         CDS       T02913                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcm01002]
    102364869 (TMPRSS2)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102364869 (TMPRSS2)
Peptidases [BR:lcm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102364869 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR Ldl_recept_a DUF1986 SRCR Trypsin_2 DUF316
Motif
Other DBs
NCBI-GeneID: 102364869
NCBI-ProteinID: XP_014342015
LinkDB All DBs
Position
Un
AA seq 487 aa AA seqDB search
MAEKVPCSPFYSLRLNESNDVTKNAQLNSVNRELQKSQLTIFDGIGLMETFKMTITDFAL
HLQEKQDFSVFNELSGSRSIVITVVVLVVLVLAGIAAALIYYFVFSCSNNKFLCENSGQC
VSASEWCDGIPQCPDGSDEKQCVRLYGPSFLLQAYSAKKQSWEPVCSDNWTNNYGQAICS
QIGYESTTYYKSGTQPQSSSSSGYLKLDPSLINTEKQFYKMLSSSKSCSMGSILTLRCID
CGTRTPPSKTSRIVGGNTAQPGNWPWQVSLQVYKTHLCGGTIITPYWIVTAAHCVEDYSD
PKQWRVYSGILKRSEMNIWKGNFVAKIIAHKGYNSKTKHKDIALMKLESPLTFSDTIRPV
CLPNFGQQFLPDTTCWISGWGSTREGGSSSNDMMVASVPIISTAECNSRLVYNGMISSTM
TCAGYLIGGIDSCQGDSGGPLVTQQHSSWWLVGVTSWGEGCARRNRPGVYGKVTELLDWI
YLTMQAN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaagtcccttgcagccctttctacagtctgcgtctcaatgaaagcaatgat
gttacaaagaatgcccagcttaattctgttaaccgggagcttcagaaaagccagcttaca
atttttgatggcattggactgatggaaactttcaagatgacaattactgactttgccctt
cacctgcaagagaaacaggacttttcagtttttaatgaactcagtggtagcagaagcata
gtcattactgtggttgtactggttgtgctggtactcgctgggattgctgctgcacttatt
tattactttgttttcagctgctccaataataaattcctttgtgaaaattcagggcaatgt
gtcagtgcttccgagtggtgtgacggaatacctcagtgccccgatgggagtgatgaaaag
caatgtgtacgattgtatgggcccagtttccttctgcaggcttactctgcaaagaaacaa
tcctgggaacctgtctgcagtgataactggactaataactatggacaagcaatatgtagc
cagattggttatgaaagcaccacttattacaagtctgggacacagccacaaagtagcagt
tcttcagggtatctaaaactagaccccagcttgataaatacagaaaaacaattctataaa
atgctgtccagcagtaagtcatgctccatgggatcaatactcactctgcgctgtatagac
tgtggcaccagaacaccacccagcaagacctctagaattgtaggaggaaatacagcacaa
ccaggaaactggccttggcaagtcagtcttcaagtatataaaacacatctatgtggaggt
accatcatcactccttattggatagtaacagcagctcactgtgtagaagattattctgat
cctaagcaatggagggtatactcaggtattctgaaacgatcagaaatgaacatttggaaa
ggtaactttgtggccaaaatcatcgcacataaaggatacaatagtaaaaccaagcataag
gacattgccctgatgaaattggagagtccactaactttttcagatacaatcagaccagtg
tgcctacctaactttgggcagcagttcttgcctgacacaacttgttggatatctggctgg
ggatccacacgtgaaggagggtcaagttcaaacgatatgatggtggccagtgtacctata
ataagtactgcagaatgtaacagcagacttgtctacaatgggatgatttcatctaccatg
acctgtgctggctacttaataggaggaattgactcttgtcagggcgacagtggaggccca
ttagttacgcaacagcattcttcatggtggctagttggagtcacaagttggggtgagggc
tgtgctcgtcgaaaccgccctggagtttacggtaaagtgactgagctgttggactggatc
tacctgactatgcaggccaactga

DBGET integrated database retrieval system