KEGG   Latimeria chalumnae (coelacanth): 102365617Help
Entry
102365617         CDS       T02913                                 

Gene name
AMT
Definition
(RefSeq) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00260  Glycine, serine and threonine metabolism
lcm00630  Glyoxylate and dicarboxylate metabolism
lcm00670  One carbon pool by folate
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    102365617 (AMT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102365617 (AMT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102365617 (AMT)
Enzymes [BR:lcm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     102365617 (AMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C AKAP95
Motif
Other DBs
NCBI-GeneID: 102365617
NCBI-ProteinID: XP_005987068
Ensembl: ENSLACG00000015348
UniProt: H3B6A3
LinkDB All DBs
Position
Un
AA seq 422 aa AA seqDB search
MGIVVVGGGAAARFALLQVAGTRLGPRSLGAAARLGLGSPDRCYSSAAQESLKKTSLYDF
HRSHGGKMVEFAGWAMPVQYKDSHIISHMHTREHCSLFDVSHMLQTKVLGKDRVKFMESL
IVGDIAELKDNQGTLSLFTNRNGGIIDDLIVTKTSDHYLYVVSNAGCADKDSAHMQNHLR
EFKAAGHDVDLEHINNALIALQGPSMVQVLQVGVADDLAKLPFMMSVMTTVFGVPGCRIT
RCGYTGEDGVEISVSHQHVVQLVETLLKNSEVKMAGLGARDSLRLEAGLCLYGNDIDEMT
TPVEASLVWTIGKRRRTTLDFPGAAIIVPQIKAKTKRKRVGLISTGPPVRQHTPLLNTEG
KVIGEVTSGCPSPCLKQNVAMGYVEAEFSKVGTPIRVEVRKKAVDTVVCKMPFVPTRYYI
VK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggggattgtggtggttggtggtggcgctgcggctcgattcgctctccttcaggtcgct
gggacacggctcgggcccaggagtttgggcgctgcggcccggcttggcttggggagtccg
gacaggtgctacagctcggctgctcaggaatctctgaagaagacctcgctgtatgatttc
caccgcagccatggtgggaagatggtggaatttgcaggctgggcgatgccagtccagtat
aaggacagccacatcatatcccacatgcacactcgcgaacactgctcactgtttgacgtc
tcccacatgctgcagactaaagttctggggaaggatcgtgtgaagtttatggagagcctg
atagtgggagacattgcagagcttaaagacaaccagggcacactatctctgtttacgaat
cgaaatggtgggattattgatgacctgatcgtgaccaaaacctccgaccattatttatat
gtggtttccaatgccggctgtgctgacaaggattctgctcacatgcagaaccacctgcgg
gagttcaaagctgctgggcatgatgtcgacctggagcatattaacaacgctctgatcgca
ttgcaaggccccagcatggtccaggtactgcaagttggagtcgccgatgacctggcgaag
ctccccttcatgatgagcgtgatgacgactgtgtttggcgtgccaggctgtagaatcact
cggtgtggctacaccggagaggatggcgttgagatttctgtgtctcaccaacacgtagtc
cagctggtggagacgctgctgaaaaacagcgaggtgaagatggctgggctcggggcccgg
gacagcctacgactggaggcggggctgtgtctctatggcaatgacattgacgagatgacc
accccagtggaagctagcttggtctggacaattggcaagcgtcgaaggactacgctggat
ttcccaggtgcagccatcattgttcctcagattaaggcaaaaacgaagcggaaacgagtt
ggtctgatttcaactggccccccagtgaggcagcacacgcccctcctcaacaccgaaggg
aaagtgatcggtgaagttaccagtggctgtccctccccttgcttgaagcagaacgttgcc
atggggtacgtagaggcagagttcagcaaagtgggaacaccaatccgagtggaggtcagg
aagaaggcagtggacactgttgtctgcaaaatgccctttgtgccaacgcgctactacatc
gttaaataa

DBGET integrated database retrieval system