KEGG   Latimeria chalumnae (coelacanth): 102365821
Entry
102365821         CDS       T02913                                 

Gene name
TSC2
Definition
(RefSeq) tuberous sclerosis 2
  KO
K07207  tuberous sclerosis 2
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04140  Autophagy - animal
lcm04150  mTOR signaling pathway
lcm04218  Cellular senescence
lcm04910  Insulin signaling pathway
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    102365821 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102365821 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102365821 (TSC2)
   04218 Cellular senescence
    102365821 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102365821 (TSC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102365821 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcm01009]
    102365821 (TSC2)
Protein phosphatases and associated proteins [BR:lcm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102365821 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP HEAT Cnd1
Other DBs
NCBI-GeneID: 102365821
NCBI-ProteinID: XP_014342210
Ensembl: ENSLACG00000000263
LinkDB
Position
Un
AA seq 1857 aa
MSKQQSKDSLTERFKVLFRLGPPRTTVKPTESKSTEFVITAEVLKELSTECGLSNRIRAI
HQVCELAKTKKFEEHAVEAVWRVVGDMLSPEQPVEARHTVLLLLKAIIQGQGERLGPLRA
YFFNAIKDYPSNEDLHERLEVFKALTENGKDITYLEDDIALFVLEWMDMGLSAGFLQVLV
NLVKFNSCYLDQNVSQMVHKICLLCNRTTSSTDIEVSLQVLDAVVCYNCLPSESLHEFII
TLCRTVNVKEFCESCWKLIRKVLGTHLGHSAIYTMCRIMEDRAKLPQPSLISVFDLSWSF
LLIELVFEMGGRNYSSPPPQKKIIISDALFWLLFQAMTCTNAVVSYEIVLSVTRLIKKYG
KELQVVTWDILLDIIERLLHQLQTLGSQELKSIVHELLSTVEELYEQNGYHGSEERLFGL
IESCSDKRPESSVLTLVSYEAESIHPAKDGWIQTLQRLMEKFFRCESRSAIRTKVLDVLS
FVLSINRQLYEEELLDYVVVPQLGHIAEDKDPQVRKLATQLLVDVAEGCYTHHFTSLIDI
IEKVVSRPLSGPTVMEASERELTSASALEDVKTGVLGLLEILQTKLYSPPASHASRVYEL
LVNHLQSHYKHMYISPVATSIRLQVFSFLLLLRADSLHRLGVPNKEGVLRFSPYCLCDSI
ESEKRVCEKKVSGTVSPPAGGSPTTSQSSSIRMGSLPYSYVFNAVLQCLKLETDWKVLKL
VLDKLPEALQYKVLILTSFCSIDQLCSTLCSLVTNRLITERLSNTPDGFSRTDVQLAVVP
VLTALTSYHNYLDQARQRELIHCLEMGLIYRCAKQCVVALTMCTIEMPDIMIKLLPALIV
KLTHISATVTMASPMLEFLSSLVRLPHLYANFVAEQYVSVFAISLPYTNPSKFHQYIVSL
AHHVIAMWFIRCRLPFRKDFVQYITKGLRSNALLPFDDTNEQSSFRARSTSLNERPKSLR
TAKTLKPGFNNSSPVKEMKELSAVDAFRSRSISVSEHAVRSRMQTSLTSSSLGSADESSL
PQADDSLKTVHLELTETCLDMMARYVFSNFSALPKRSPLAEFLLAGGRSMTWLVGNKLVT
ITTSSGAGTRSLFDSDPADQQNFAEMTRSDPSLQVRQTKEAPAKLESQAGQQIWRGSRLR
VRSMSGGHGLRAGVAESLSPLVSPSDSEFCGPLPQRLEGSTTYRPVTSNPMTQRSAQKEK
PNLTDYAPLLTQGWAEIFIRRPSGNTSWLMCLENPPSPFSSDVGNMPLQELANVLMAVEK
VKTHQEVQLHKSFSVSCPMRSTVAPKPSLLQRSNTVASFSSMFQSSCQEKLHRSISWADS
VVVLEEGSQPEMSLKESASTLESQDNDDFVAIDPEPIFITEKFMKSQETYSRSSSTSSQE
DDKSSQAELMGSGGIPIERAIMPSSETAMEGELAFQPSQTLNKSSSSPELQTLQEVIADG
SSKDNIVKRNTEVKPKSRSGSAEGEGNTKGTNGKVEGSSCYDRNRLELSAPPQAPQSPSG
YRPRGHTISESVPSRRGRKGGRESFQHRSAASNSEKMAGISPSFVFLQLYHSPFFGNESN
KPLLLPKLQLIDRAVKVLDQMPPYDTHKIGVVYVGEGQVNNEVAILSNEYGSYRYAQFLT
GLGKLIHLEDCDPDQIFLGGLDQYGDDGQFTYCWHDDIMQAIFHIATLMPTRDFDKGCCN
KKRHIGNDFVIVVYNDSREEYKLGTIKGQFNFVEVVIKPLDYETNLVTLQCRKDLEGLVD
TSLAKIVSDKNLPLLVRQLALHGNMASLVHQNRSNPTDAYASKWLARLRQIKKIRNRAQE
EIQSRQNQGIFVSQMHTPVQSKSHPSHSQAAQASALGVETGQRKRLVSTVDDFTDFV
NT seq 5574 nt   +upstreamnt  +downstreamnt
atgtcgaagcagcagtcaaaagactccctgacggagcggttcaaggtgctgtttcgatta
ggaccacctcggaccactgtcaagcccacagagagcaagtctacagagtttgtcataact
gcagaagtactgaaggagctgagtactgaatgtggattgagcaaccgaataagagccata
catcaagtgtgcgagttagcaaaaaccaagaagtttgaagagcatgcagtagaggctgtc
tggcgagtagtgggggatatgctgagcccagagcagccagtagaagcgagacacacagta
ctgctgctgttaaaagctatcattcagggacagggggaaaggctagggcccctcagagcg
tatttcttcaatgccattaaagactatccatccaatgaagaccttcatgaaagacttgaa
gtttttaaagctctcacagagaatggcaaagacataacatacttggaagatgatatagct
ctgtttgtcttagagtggatggatatgggtctgtctgcagggttcctgcaggtcctggtc
aatttggtcaagttcaacagctgctacttggatcagaatgtttctcagatggttcacaag
atatgtctcttgtgcaaccgaaccacatcatccacagacatagaggtttctctgcaagtt
ttagatgctgttgtctgctataactgcctaccttcagaatcccttcatgagtttatcatc
acgctgtgtcgtaccgttaatgttaaggagttctgtgagtcatgctggaagctgatacga
aaagtgttggggacccatttaggacacagtgccatctatactatgtgccgtattatggaa
gacagagctaagctaccacagccttctcttatttcagtctttgatttatcatggtctttc
cttttaatagaactggtatttgaaatgggagggaggaattattcttccccccccccccaa
aaaaaaatcatcataagtgatgcacttttttggttattgtttcaggctatgacctgcacg
aatgcagttgtgtcttatgaaatagtgctgtcagtcaccaggttaatcaaaaagtatgga
aaagagctacaggtggtcacatgggatattcttctggatattattgaaagactacttcac
cagcttcagaccttaggtagccaggagctaaagtccattgttcatgagcttttaagcaca
gtagaagaactgtatgagcagaatgggtaccatggatccgaggagcgattgtttgggctc
atagagagttgttccgacaaaagacctgaatcctctgtcctaactttggtgtcttacgaa
gcagagtctattcaccctgctaaagatggctggattcaaactctccagagattaatggaa
aagttcttcaggtgtgagagtcgtagtgccattcggaccaaagtgctagatgttctgtcc
tttgtgctaagcatcaaccggcaactttatgaggaggagctccttgattatgtagtggtc
ccacagctgggtcatatagcggaggataaggatccccaggtgcgaaaactggccacacag
ttgctggtggatgttgctgaaggctgctatacacatcactttaccagtctgattgatatt
atagaaaaggtagtcagtcggcccttgtctggccctactgtaatggaagcatctgagcga
gagttgacctctgcctctgctttggaggatgtgaaaactggtgtcctgggcctattagaa
attctacagacaaagttgtacagtcccccagcaagccacgctagtcgagtgtatgaatta
ctggtaaatcatctccagtcccattacaagcacatgtatatatctccagttgccaccagt
attcgattacaggtcttcagctttcttctgcttcttcgtgctgattcccttcatcgtctt
ggagtacctaacaaggagggagtgctaaggtttagcccatactgtttatgtgactccata
gaatctgagaaacgtgtatgtgagaagaaagtttctggaactgtgtctcctccagctggt
ggtagtcctaccacctctcaaagttcctctattcgcatgggctccttgccgtactcttat
gttttcaatgcggtcctgcagtgcctaaaactggagactgactggaaggtgttgaagcta
gtgcttgataaattgccagaggctcttcagtataaagttctcatcctgacctctttctgc
agcatagaccagctctgctctactctttgctccctggtaactaatcgattgataacggag
cggctaagcaacaccccagatgggttctctcgcacagatgtacagctggcagtagttcca
gtactgactgctctgacatcctatcataattacttagaccaggccagacagcgtgaattg
atccattgcctggagatgggtcttatttaccgctgtgccaagcagtgtgtggtggcttta
accatgtgcacaattgagatgccggacatcatgatcaaactgcttcctgccttgattgtc
aagttgacccacatttcggccaccgttactatggcttcacccatgctggagtttctttcg
agtctggttaggctgcctcacctttatgcaaactttgttgctgagcagtacgtcagtgta
tttgctatctcactgccttacaccaacccttccaaatttcaccaatacattgtgtcacta
gcgcatcatgtgattgccatgtggtttatccgatgtcgcctgccttttcggaaagatttt
gtgcaatatatcacaaagggtttaaggtcaaatgccttgttgccgtttgacgatacaaat
gagcaaagtagctttcgagctcggagcaccagccttaatgagcgcccaaaaagtttgcga
acagccaaaaccttaaaaccaggcttcaataactcctccccagtaaaagaaatgaaagag
ctctccgctgttgatgccttccgatcccgcagcatcagtgtgtccgaacatgcggtccgc
agtaggatgcagacctccctcacaagttcgagtttgggctctgcagatgagagttcattg
ccgcaggctgatgacagccttaaaactgttcacctggagctcacagaaacctgcttggat
atgatggcccgatatgttttctcaaacttttcagctctccccaagagatccccattggca
gaatttctccttgctggtggaagaagcatgacctggttggtaggtaataaactggtaaca
ataaccaccagcagtggggctggaaccaggtcactgtttgacagtgaccccgcggatcag
cagaactttgcagaaatgaccagatcagacccttctttacaagtaaggcaaacaaaagag
gcaccagcaaaactggaatcgcaggcaggtcagcagatatggagagggtctcgcctccgt
gtcagatcaatgtctggtggtcatggtctccgtgctggtgttgcagagagcttgagccca
ctggtttctccctcagacagtgaattctgcggtccactaccccagaggttagaaggttcc
actacatatagaccagtgacctcaaaccccatgacgcaacgatctgctcagaaggagaag
cctaatttaactgattatgcacctctattgactcaagggtgggcagagatctttatccgt
aggccttcaggtaataccagctggctgatgtgtctagagaatccacctagccccttctcc
tctgatgttgggaacatgcctctacaagagcttgccaatgtgctgatggctgtcgagaaa
gtgaagacacatcaggaggtccagctgcataaatccttttcggtgtcctgtccaatgagg
tccactgtagcacccaagccatccctccttcaacgctcaaacacagtggcctctttctct
tccatgttccagtccagttgtcaagaaaagttgcacaggagcatttcctgggcagactct
gtagtggttttagaagaagggagtcagcctgagatgagcctcaaagaaagtgcttctaca
cttgaatctcaggacaatgatgactttgtagccattgaccctgagcccatctttatcacc
gagaagttcatgaaatcccaggaaacatacagcaggtcatcctcgacttctagccaagaa
gatgataaatcttctcaagctgaattaatggggagtggaggcattcctattgagagagcc
attatgccctcttctgaaactgctatggaaggagaactggctttccaaccttctcaaact
ctcaacaagtcaagctcctcccctgagcttcagaccttacaggaggttatcgcagatggc
agtagtaaagataacattgtaaaacgcaacaccgaagtcaaacccaagtctcgttcagga
agtgcggaaggagaggggaataccaaagggacaaatggcaaggttgagggaagtagctgt
tacgatcggaaccggttagagctttctgcacccccacaggctcctcagtctcctagtggg
taccggccaagaggacacacaatctcagaatctgtcccctcccgtagagggaggaaaggg
ggaagagagtcttttcaacacagatctgcagcttctaactcggagaaaatggctgggata
agtccaagctttgtatttttgcaactgtaccattctcctttctttggaaatgaatccaac
aagcccttgctattaccaaagttgcagctaatagacagagctgtaaaagtcctggatcag
atgccaccatatgacacccacaagataggcgttgtatacgtgggggagggccaggtcaat
aatgaggtggctattctatcaaatgaatatggctcctacaggtacgcacagtttttaact
ggtttaggcaagctgatccacctggaagactgtgatcctgatcagatattccttggggga
cttgatcaatatggtgatgatggccagtttacttactgctggcatgatgacattatgcag
gccattttccacattgcaaccttaatgccaactagagactttgataaaggctgctgtaac
aagaagagacatattggaaatgactttgtaattgtggtctacaatgattctcgggaggag
tacaagctaggcaccatcaagggacagtttaactttgtggaagttgtaatcaagcctttg
gactacgaaaccaatcttgttacactacagtgtcgcaaagatttggagggactagtggat
acaagtttggcaaaaattgtatctgataaaaatttgcctttgttagtccgacagctagcg
ctacatggaaatatggcttcccttgtccaccaaaaccgatcgaatcctacagatgcttat
gcctccaagtggttagccagactacggcagatcaagaaaatcagaaacagggcacaggaa
gaaattcagtcccgtcagaaccagggaatatttgtatctcaaatgcacacccctgttcag
agtaaatctcatccatctcattcgcaagcagcacaggcatctgccttaggtgttgaaaca
ggacagagaaagaggctggtttccactgtggatgattttacagactttgtataa

DBGET integrated database retrieval system