KEGG   Latimeria chalumnae (coelacanth): 102366102Help
Entry
102366102         CDS       T02913                                 

Definition
(RefSeq) serine/threonine-protein kinase B-raf-like
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04012  ErbB signaling pathway
lcm04068  FoxO signaling pathway
lcm04150  mTOR signaling pathway
lcm04270  Vascular smooth muscle contraction
lcm04510  Focal adhesion
lcm04810  Regulation of actin cytoskeleton
lcm04910  Insulin signaling pathway
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102366102
   04012 ErbB signaling pathway
    102366102
   04068 FoxO signaling pathway
    102366102
   04150 mTOR signaling pathway
    102366102
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102366102
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102366102
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102366102
   04914 Progesterone-mediated oocyte maturation
    102366102
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102366102
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102366102
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102366102
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102366102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 102366102
NCBI-ProteinID: XP_014347064
LinkDB All DBs
Position
Un
AA seq 181 aa AA seqDB search
MQDKNPYSFQSDVYAFGIVLYELMTGQLPYLNINNRDQIIFMVGRGYLSPDLSKVRSNCP
KAMKRLMAECLKKKREERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLY
ACASPKTPIQAGGYGITAPQMKFKETRSPSSELSNSPRSPNVPLNASQAEGHEQAHNCNG
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcaggataaaaacccctacagctttcagtcagatgtctacgcctttggcattgtcctg
tatgaactaatgacagggcagttgccgtatttaaacatcaataaccgtgatcagataatt
tttatggttggccgaggctacttatctcctgatcttagcaaagtgcgtagcaactgcccg
aaagccatgaagaggctgatggcggaatgtctaaaaaagaaaagggaagagaggccactt
tttccacagattcttgcctctatcgagctgttggcccggtcattgccgaaaattcatcgc
agcgcatcagagccctcgttgaaccgagctggcttccagacagaagatttcagcctctat
gcctgtgcttctccaaaaacgcctatccaggcagggggatacggtattacagcgccacag
atgaagtttaaagagacacggtcaccttcttcagagctcagcaattctccacggagcccc
aacgtgcctttgaacgccagtcaggcagaaggtcacgagcaggcgcacaactgcaatgga
ccttga

DBGET integrated database retrieval system