KEGG   Latimeria chalumnae (coelacanth): 102366539
Entry
102366539         CDS       T02913                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04137  Mitophagy - animal
lcm04210  Apoptosis
lcm04216  Ferroptosis
lcm04218  Cellular senescence
lcm04310  Wnt signaling pathway
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102366539 (TP53)
   04310 Wnt signaling pathway
    102366539 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102366539 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102366539 (TP53)
   04210 Apoptosis
    102366539 (TP53)
   04216 Ferroptosis
    102366539 (TP53)
   04115 p53 signaling pathway
    102366539 (TP53)
   04218 Cellular senescence
    102366539 (TP53)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102366539 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcm03000]
    102366539 (TP53)
   03036 Chromosome and associated proteins [BR:lcm03036]
    102366539 (TP53)
   03400 DNA repair and recombination proteins [BR:lcm03400]
    102366539 (TP53)
Transcription factors [BR:lcm03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102366539 (TP53)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102366539 (TP53)
DNA repair and recombination proteins [BR:lcm03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102366539 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD DEC-1_N
Other DBs
NCBI-GeneID: 102366539
NCBI-ProteinID: XP_005999860
Ensembl: ENSLACG00000014014
LinkDB
Position
Un
AA seq 462 aa
MLGNSPARVECEPGGSGQGSRGIRVLPEARIGETVSFSCSCGNGVLPEATMTDPMSESGL
EPLSQESFADLWNLLPTSMSNNVDLLPEETWQAELDDLRLPGEMGAPLQTMTVSSNFGAF
LESELEAGLASAAPPPPAPPAPSGESIPVTSSVPSTEDYAGDHNFQLIFQQSSTAKSVTC
TYSFTLNKLFCQLAKTCPVQIKVDAAPPPGALIRTIAIYKKSEHIAEVVRRCPHHERCAD
LNDGLAPASHLIRVEGNRLAQYIEDRNTQRQCVIIPYECPQVGSECSTVLYNFMCNSSCM
GGMNRRPILTIITLETKEGRLLGRRCFEVRVCACPGRDRKTEEENSHKQQEKANPKTAIK
RALREVSCSDSGPYKKRAVNPEEELYSLQVRGRERYEMFKKLNNALELQDSVSAAETEKH
KTKPSKNASRKELEPKKGKKLLVKEEGSGGGGGGGGGGNDSD
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgctggggaattccccagcgcgtgttgagtgcgagccaggcggcagcggacaagggagc
cgcgggatccgagtcctcccggaggcacgcattggcgaaactgtttctttcagctgttcc
tgtggtaacggggtgcttcctgaagccaccatgactgacccgatgtcggagtctggcctg
gagccactgagccaggaatcattcgctgacctttggaatctccttcccacatccatgagc
aataatgtggatctactgccagaggagacttggcaggcagagctcgacgatctcaggctg
ccgggggagatgggggctcctttacagaccatgacggtctccagtaacttcggggccttc
ttggagtctgagctggaggcggggctcgcctctgctgctcctcctcctcccgccccacct
gcgccctctggcgaatccatccctgtcacctcgtccgtcccctccacagaggactacgcc
ggtgaccacaacttccagctgatcttccagcagtccagcactgccaagtcagtcacctgt
acttattcattcaccttgaacaaactcttctgccagctggcaaaaacctgccccgtccag
atcaaggtagacgccgccccgcctcctggcgccctcatccgcaccatcgccatttacaag
aagtcggagcatattgctgaagtggtgagacgctgcccgcatcacgagcgctgcgctgac
cttaacgatggtctggctccggcaagtcacctgatccgagtggaggggaaccgtctggcg
cagtacattgaggataggaacacccagcgccagtgtgtcatcattccctacgagtgccct
caggtcgggtccgagtgctccactgtcctgtacaattttatgtgcaacagcagctgtatg
ggaggcatgaacaggcgacccattctcaccatcatcacgctggagaccaaagagggtcga
ctgctaggccgccgctgcttcgaggtgcgcgtctgcgcctgcccagggcgagaccgtaaa
acggaggaagagaacagccacaagcagcaggagaaagccaaccccaagacagccatcaaa
cgcgccctgcgggaggtttcgtgctcggactccggtccttacaagaagcgggctgtgaac
cccgaagaggagctctactccttgcaggtccgtgggcgggagaggtatgaaatgttcaag
aagctgaacaatgctctggagcttcaggactccgtgtcggcggctgaaactgagaagcac
aaaacaaaaccgtcaaaaaacgcatcgaggaaggagctggaaccaaagaaaggcaagaag
ttactggtgaaagaagaaggcagtggtggtgggggcggtggtggtggcggcggcaacgac
tcggactga

DBGET integrated database retrieval system