KEGG   Latimeria chalumnae (coelacanth): 102366560
Entry
102366560         CDS       T02913                                 

Gene name
CDK2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102366560 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102366560 (CDK2)
   04114 Oocyte meiosis
    102366560 (CDK2)
   04115 p53 signaling pathway
    102366560 (CDK2)
   04218 Cellular senescence
    102366560 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102366560 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102366560 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102366560 (CDK2)
   03036 Chromosome and associated proteins [BR:lcm03036]
    102366560 (CDK2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102366560 (CDK2)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102366560 (CDK2)
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102366560 (CDK2)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102366560 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 102366560
NCBI-ProteinID: XP_005986281
Ensembl: ENSLACG00000018959
UniProt: H3BI57
LinkDB
Position
Un
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGQVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNVVKLLDVIHTENKLYLVFEFLHQDLKKYMDSSSISGVPVPLVKSYLFQLLQGVAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEMVWPGVTSMPDYKTTF
PRWCRQDFSKVVPPLNEDGRDLLAQMLHYDPNKRISAKTALQHPFFQDVTLATPHLRP
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccagaaagtggagaagatcggcgagggcacctacggggtggtgtataag
gccaaaaacaaagtcacagggcaggtagtggcgctcaagaagatccgcctggatactgaa
acggaaggtgttccgagtacagcgatccgtgagatctccctcctgaaggaactgaatcat
ccaaacgttgtcaagttactggatgtcattcacacggagaacaagctctacctggttttc
gagttcctccatcaggacttgaagaagtacatggactcctcatctatctctggagtccct
gtgccgctggtcaagagttacctgttccagctgttgcagggtgtggcgttttgccactcc
caccgagttctccaccgggacctcaagccgcagaacctgctcatcaacgccgaaggcgcc
atcaagctcgccgactttggactggccagggcatttggcgtgccggtgcggacatacacg
cacgaggtggtgaccttgtggtatcgagctcccgagatcctgctgggttgcaaatactac
tccacagccgtcgacatctggagtcttgggtgcatctttgcggaaatggtgaccaggaga
gccctgtttcctggggactcggagatcgaccaacttttccggatattccggaccttggga
acgccagatgagatggtgtggccaggagtgacctccatgccggactacaagaccaccttc
cccaggtggtgcaggcaggatttcagcaaagtggttccgcccttaaacgaagatgggaga
gacttactggcgcaaatgcttcactatgaccctaacaagcgaatttctgccaagactgcc
ctgcagcatcccttcttccaggatgtgacccttgcaacccctcaccttcgaccctga

KEGG   Latimeria chalumnae (coelacanth): 102367189
Entry
102367189         CDS       T02913                                 

Definition
(RefSeq) cyclin-dependent kinase 2-like
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102367189
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102367189
   04114 Oocyte meiosis
    102367189
   04115 p53 signaling pathway
    102367189
   04218 Cellular senescence
    102367189
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102367189
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102367189
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102367189
   03036 Chromosome and associated proteins [BR:lcm03036]
    102367189
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102367189
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102367189
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102367189
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102367189
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH
Other DBs
NCBI-GeneID: 102367189
NCBI-ProteinID: XP_006010583
Ensembl: ENSLACG00000007742
UniProt: M3XGV4
LinkDB
Position
Un
AA seq 296 aa
MEVFRKVEKIGEGTYGVVYKAVNKLTGDMVALKKIRLDAETEGVPSTAIREISLVKELNH
PNIVELLDVIHREKKLYLVFEFLSQDLKKYMDSSKSTRLPLPLIKSYLYQLLLGVSYCHS
HRVIHRDLKPQNLLINEIGDIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSIGCIFAEMITGRPLFPGDSEIDQLFRIFRTLGTPNESVWPGVTHLPDYKANF
PQWCKQDVNTIVPSLNADGKDLLTQLLQYDPNKRISAKAAISHRYFHDVRTHAPNF
NT seq 891 nt   +upstreamnt  +downstreamnt
atggaggttttccggaaagttgaaaagattggagaagggacttacggggtggtttataaa
gccgtcaacaagctgacaggagacatggtggcccttaaaaagatccggctggacgcagaa
actgaaggtgtgcctagtactgccattcgagagatctctctggtaaaagagctgaatcac
cccaacatagttgaattgcttgatgttatccatagagaaaagaaactgtacctggtattt
gaattcttaagccaggacttgaagaaatacatggactcctccaagtctacaagacttcca
ctgccgttaataaagagctatttgtaccagctgcttctgggtgtgtcctattgccattct
catcgagttatccatcgagacctgaagcctcaaaacttattgataaatgaaataggagat
attaaattggcagattttggattagcaagggcttttggcgtccctctgcgaacttacact
cacgaggtggtaactttatggtaccgggctccagaaatattactgggatgtaaatactac
tcgactgcagtggacatttggagcataggatgcatatttgcagaaatgattacagggagg
cctttgtttcctggagactctgaaattgatcagctcttccgaatattccggaccttgggg
acgccaaatgaatctgtttggcctggagttacccaccttccagattataaagcaaacttc
ccacaatggtgtaagcaagatgtcaacactattgttccaagtttgaatgcagatggaaaa
gacttattgacgcaattgcttcagtacgatcccaacaagagaatttcagcaaaggcagcc
ataagtcatcggtatttccatgatgtgagaactcatgcacctaatttctaa

DBGET integrated database retrieval system