KEGG   Latimeria chalumnae (coelacanth): 102366792Help
Entry
102366792         CDS       T02913                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00052  Galactose metabolism
lcm00500  Starch and sucrose metabolism
lcm01100  Metabolic pathways
lcm04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102366792
   00500 Starch and sucrose metabolism
    102366792
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102366792
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102366792
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102366792
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102366792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 GHL15
Motif
Other DBs
NCBI-GeneID: 102366792
NCBI-ProteinID: XP_005999031
Ensembl: ENSLACG00000011053
LinkDB All DBs
Position
Un
AA seq 923 aa AA seqDB search
MFSYQKLPSDKLDPSNSHLDARETKIFLRQGVQRGLSTKCLCISVLLLAFLLSLGTAWFV
SEALLESRVGDQHVVQLVPPEQEQLDGQTTPEVCGAVPETHRFNCYPEIYVIVTRSLCES
RGCCFIKMPLPPPGKGGVPWCFYPPNFPSYSLDRLNKTGLGFSGELTRKTKTYYPKDIER
LELNVTFETNSRLHIKITDSTSPRYEVPIKVPQVTERATDPIYSVEFSKDPFGVIVRRNS
NGLVLLNTTVAPLFFTDQFLQISTMLPSQYLYGLGEHQSGFLHNFEWNTLNFWARDIPPM
ENSNLYGVHPFYLVMEPGGISHGFFLLNSNAMEVALQPAPALTWRTIGGILDFYIFMGPD
PSSVISQYLEVIGFPMMPPAWGLGFHLCRWGYGSSNATWHIVKTMRNYGIPQDAQWNDID
YMDGFRDFTFDSKKFATLPQLVKDLHNYGQHYVMILDPGISSTQQPGSYPPYDEGLKRDI
FINTTDGKLLIGEVWPGKTAFPDFTNPETHQWWYESLTRLYQQVPFDGLWIMPRLHNNAF
MYPLFWSGVKGGSLRVKTICASAKQKESVHYNVHSLYGLMEAKATASALKKLRGKRPFVI
SRSTFPSQGRYSGHWLGDNRSQWKDLYWSIPGILNFNMFGIPLVGADICGFSGSATEELC
VRWMQLGAFYPFSRNHNTQGEQAQDPLAFGPLARSAMKEVLLIRYSLLPYLYTLFHRAHI
YGDTVATPLFFQFPEDITTYSIDRQFLWGRSLLVTPVLEAGVDSVIGYFPKGVWYDFYMV
LGNKYNVITRWFFFFFSLKTPSTTTWMSSGNPMQLIVALSENATANGDLFWDDGESLDTY
ETSNYSYMVFNVTQNTLTSTVLHVNVEATFIIVDKVTVFGVKRQPSKVTVNGKEASFSYL
PNQVLAVSNLYLKLSDGFSISWI
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgttctcatatcagaagttgccatctgacaaacttgatcccagcaattctcaccttgat
gccagggaaacaaaaatatttcttaggcaaggtgttcagaggggactttcaaccaagtgc
ctttgtatttctgtattactgctggctttccttctgagccttgggaccgcctggttcgtc
agcgaagcccttttggagtccagggttggagatcaacatgtggtgcaactagtccctcct
gagcaggagcagctggatggacagacgacccctgaagtatgtggtgctgttcctgagact
catcgctttaactgctacccagagatttatgttattgtcacgcgctccctgtgtgagagc
cggggctgctgctttatcaaaatgcccctcccccctccagggaagggtggggtcccctgg
tgtttttatcctcccaatttcccaagttactctttagacaggttgaacaaaactgggttg
ggattcagtggtgaactgacaaggaagacgaaaacctattacccaaaagatatagagagg
ctggagctgaacgtgacgtttgagacaaactccagattgcacatcaagataactgattcc
acatctcctcggtatgaggttcccattaaggttccacaggtcacagagagagctactgac
ccgatttactccgtggagttttcaaaggacccgtttggggttatcgtgagaagaaattcc
aatggattagtattactcaacacgacagtggctcccctatttttcacggatcagtttctc
cagatatctacgatgctcccttcccagtatctttatgggctgggggagcatcagtctggc
ttcctgcacaacttcgagtggaacaccttgaatttctgggcccgggatattccaccaatg
gaaaactctaatctgtatggagtccatccattctacctggtgatggagccaggaggaatt
tcccatggattttttctcctgaacagcaatgctatggaggtggccctccagccagcccca
gctcttacctggcgcactattgggggaatcctggacttttacatcttcatgggtcccgac
cccagctctgtcatctcacagtacctggaagttatagggtttcccatgatgcctccggct
tggggtttgggctttcatctttgtcgctggggttatggatctagcaatgccacctggcac
attgttaaaaccatgcggaattatgggataccacaggatgcccagtggaatgatatagac
tacatggatggatttcgggatttcacctttgactctaaaaagtttgccacactcccccag
ctagtgaaagacctgcataactatggacaacattatgtcatgatactggatcctggaatc
agtagcacacagcagccaggctcttacccgccttatgatgaggggctgaaacgggacatc
tttatcaatacgacagatggaaaactcttaattggggaggtgtggccaggaaagactgca
ttccctgattttacgaaccctgaaactcaccagtggtggtacgagtctctgacacggctc
tatcagcaagtgccatttgacggactttggattatgccacggctccataataatgctttc
atgtatcctttattttggtcaggggttaagggaggatccctgcgagtaaagactatctgt
gcttcagccaaacagaaggaatccgttcactacaatgtccacagcctatatggattgatg
gaggccaaagctactgccagtgctctaaagaagctgcgtgggaaacgtccctttgtgatc
tctcgttccacattccccagtcagggacgctattctggacactggcttggggataacagg
agtcagtggaaggacctgtattggtccataccagggatactaaacttcaatatgtttggg
atcccgctggtgggagccgatatctgtggattttctggaagtgcaacagaggagctgtgt
gttcggtggatgcagcttggagcattttatcccttttcccggaaccacaacacacaaggg
gagcaggctcaagatccccttgcatttggcccccttgcccggagtgctatgaaggaagtc
ctgttgattcgttactctttgttaccatacctctacacattgttccatcgtgcccacata
tatggagacactgttgctacacctctctttttccaatttccagaggatatcaccacttac
tcaattgataggcagtttctttggggacggagccttcttgtgactccggtgctggaggca
ggagttgactctgtgattgggtacttcccaaagggtgtctggtatgacttttatatggtc
cttggaaacaaatacaatgtgatcacccgatggttttttttttttttttctttaaagact
cccagcaccaccacatggatgagcagtggaaacccgatgcaactgattgtagccctgtca
gagaatgcaacagctaatggggacctgttctgggatgatggagaaagtctggacacctat
gaaactagcaattattcctatatggtgtttaatgtcacacagaacaccctaacttccaca
gtactacatgtgaatgtggaggctactttcattattgtggacaaagtgactgtgtttggg
gtcaaaaggcagccgtcgaaagtcacagtaaatggaaaagaggcctcattttcctatttg
ccaaaccaggttctagcggtcagtaacctgtacttgaagctcagtgacggattctccatc
agctggatataa

DBGET integrated database retrieval system