KEGG   Latimeria chalumnae (coelacanth): 102366829Help
Entry
102366829         CDS       T02913                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00512  Mucin type O-glycan biosynthesis
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102366829 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcm01003]
    102366829 (GALNT9)
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102366829 (GALNT9)
Glycosyltransferases [BR:lcm01003]
 O-Glycan biosynthesis
  Mucin-type
   102366829 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102366829
NCBI-ProteinID: XP_014344525
Ensembl: ENSLACG00000005795
LinkDB All DBs
Position
Un
AA seq 637 aa AA seqDB search
MAVPRKIKTLLTVNIFVFVGIILFSVYCRIQDRSEELIQIVRSSDRRPRSRNAKVGTLLD
RESILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGLAATLRDDSHESETKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKHTRYSSDLPQIAVVFIFVNEALSVILRSVHSVVNHTP
SHLLKEIVLVDDNSDNVELKFNLDQYVNKRYPGLVKVVRNTKREGLIRARIQGWKATTAA
VVGFFDAHVEFGIGWVEPILTRVKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDKGDESAPIKTPAMIGCSFVVDREYFGELGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEFKSHVYMAWNIP
MINPGVDFGDISERIALRKRLQCRSFKWYLQNVYPEMRIYNNTVTYGEVSFFQLYCMTHQ
CSRTGKVSTSLNHHSKLRQGGLRKRIEARDENERKVNEERRYNATQCEPDANRLVRYTAD
GFLQLGPLGSTTFLPDTKCLVDDGKGRTPSLRKCEDVSRPAQRLWDFTHSGPIVSRDTGR
CLEVEMSKDANFGLRLVVQRCSGQKWMIRNWMKHPRH
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgccacggaaaattaaaactttgctgactgtcaacatcttcgtcttcgtgggg
atcatcttgttctcggtctactgccggatccaggaccgatctgaggagctgatacagata
gtaagaagttctgaccgcagaccaaggagcaggaatgcaaaagtcggtactctgttggac
agagaatcaatattgcaaaggctggatcatctggaagaggtggtctacaaccagctaaat
ggtctagccaagcctatgggcctggtggaagggcctggaggcctgggacagggggggctg
gcagctaccctcagagacgacagtcacgagtcggaaacaaaatatgaagaatacggatac
aacgcccagctcagcgacaggatctctttggacaggtctataccggattacagaccaaaa
aagtgcaaacacacgagatactccagcgatctgcctcagattgcagttgtcttcattttc
gtgaacgaggctctgtctgtcatcttgcgctcggtgcacagcgtcgtgaaccacacgcct
tcccatctgctcaaggagattgttctcgtcgatgacaacagcgataacgttgagctgaag
tttaacctggaccagtatgtcaataaacggtaccctggacttgtgaaggtcgtacgtaat
accaagagggagggtctgatccgggccagaatccagggctggaaagctacaactgctgct
gttgtggggttctttgatgcccacgttgagttcggtataggctgggtggagcctatcctg
accagggttaaagaagaccacactcgaataattcttccagccatcgacaacatcaagtac
aacacgttcgaggtacagcagtatgccaacgcagctcatggatataactggggactctgg
tgcatgtatatcattccgcctcaagactggctggacaagggggacgaatccgctccaatc
aagacgccagcaatgatcggctgctcttttgtggttgaccgagagtactttggcgagttg
ggcctgctggatcctgggatggaggtttacggaggggaaaatatcgaactgggcatgagg
gtgtggcagtgcggagggagtatggaggtcctgccgtgttccagagtcgctcacattgaa
cgcacaaagaagccctacaataatgacattgattactatgcaaagcggaatgccctgaga
gctgcagaggtttggatggacgagttcaaatctcatgtctacatggcatggaacatacca
atgatcaatccaggagtagacttcggcgacatttctgaaagaattgctcttcgaaaaaga
ctgcagtgtcggagtttcaaatggtacttacaaaacgtttacccagaaatgaggatttat
aataatacagtcacttatggggaggtaagcttcttccaactgtattgcatgacacaccaa
tgctcaagaactggaaaggtgtccacatccctaaaccaccattccaagctgagacaaggt
ggcttgcgcaagcgcattgaggccagagacgaaaacgaaaggaaagtcaacgaagaaaga
cgatacaacgcgacacagtgcgagcccgacgcgaatcggcttgtccggtacaccgcagac
gggttcctacagctggggccgctgggctccaccaccttcttgcccgacaccaaatgtctg
gtagatgacgggaaagggcggacgccgagtctccggaagtgcgaagatgtctctcgaccc
gcacagaggctttgggactttacgcacagcggcccaatcgtcagcagagacactggaagg
tgcctagaagttgaaatgtcaaaagatgccaattttgggctgaggctggtcgtccaaagg
tgctctggacagaagtggatgataaggaactggatgaagcacccgaggcattga

DBGET integrated database retrieval system