KEGG   Latimeria chalumnae (coelacanth): 102366909Help
Entry
102366909         CDS       T02913                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm03030  DNA replication
lcm03410  Base excision repair
lcm03420  Nucleotide excision repair
lcm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102366909
   03410 Base excision repair
    102366909
   03420 Nucleotide excision repair
    102366909
   03430 Mismatch repair
    102366909
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102366909
   03400 DNA repair and recombination proteins [BR:lcm03400]
    102366909
Enzymes [BR:lcm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102366909
    6.5.1.6  DNA ligase (ATP or NAD+)
     102366909
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102366909
DNA replication proteins [BR:lcm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102366909
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102366909
DNA repair and recombination proteins [BR:lcm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102366909
   NER (nucleotide excision repair)
    Other NER factors
     102366909
   MMR (mismatch excision repair)
    Other MMR factors
     102366909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 102366909
NCBI-ProteinID: XP_014351530
LinkDB All DBs
Position
Un
AA seq 1067 aa AA seqDB search
MQRSIASFFQPLKAQKSKKEEKGDGERKLEREVRKSPLKVKNGLMSEQIDDSPVKRLAKK
SCRALASEEEEEEEEWQRAKRQKQEKAAGEKRDGKHGKKTAEEVKLAKEREEEKQEKKTM
EEEEDADEQKPTGAESEHDAEEDVDQQKPIGSELEHNTKEDDQQSGSAEGKQSPSVGNTP
IKANGKQQETQSLVSTPCTGTPTSRTSPQESPALSDSPGVSPSGIPKRRTARKQLPKRKL
DSTVRSSSNSSESGSPSNKAVRLAETDEEKGEEKAEPEEWQEEEMEIGEVKGQSSPEQQD
AGTNGEKGGGDESKRRVEEKQQEEERESDSEGSPKIKTEEKVEEEEKSVEKAKVPISSFF
APRKPAMKLEKKEEAGLEKAANQSKAPETSNKGNKTANFFGGAKSDASQESASEYNPSKA
RYHPVDNACWSHGEKVPYLAVSRTFEKIEEESARLKNIETLSNFLRSVIVLSPNDLLPCI
YLCLNRLGPAYEGLELGIGETILMRAVAQATGRQLEKIKAEAQEKGDLGLVAESSRSNQR
TMFTPPKLAASGVFAKLKEIGKMTGSASMNKKIDIIKGMFVACRHSEARYIIRSLGGKLR
IGLAEQSVLAAIAQAVCLTPPGQEFPPKVVDAGKGITSESRKSWIEEKALILKQTYCELP
SYDVIVPVLLKEGIEELPKHCKLTPGIPLKPMLAHPTKGIGEVLKRFDEAAFTCEYKYDG
ERAQIHILESGEVHVYSRNQENNTSKYPDIIDRIPKVKKDHVTSCIIDSETVAWDPEKKQ
IQPFQVLTTRKRKDVDATEIKVQVCVFAFDLLYLNGESLVKEPFVKRRELLRQAFTETEG
EFMFATAMVGSNTEEIADFLEQSIKDSCEGLMVKTLEVDATYEIAKRSHNWLKLKKDYLE
GVGDTLDLVVIGAYLGKGKRAGAYGGFLLACYDDENEEFQSICKIGTGFKDEDLEQHHSF
LKEHVIDKPRSYFRWDSSAEPDHWFDPTQVWEVKCADLSISPVHKAAVGLVDEDKGISLR
FPRFLRIRDDKKPEDATTSSQVADLYRKQQQIQNQQNGAEKTEEDYY
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggtcgatagcgtccttcttccaaccattgaaggcccagaaaagtaaaaaagag
gagaagggagacggagagagaaaattagagagagaggttcggaagtcccctctgaaggta
aagaatggcttgatgtcggagcaaatagatgactcgcctgtgaagaggctggcaaagaaa
tcatgccgggccctggccagtgaggaagaggaggaggaagaggagtggcaaagagctaaa
aggcagaaacaagaaaaagctgcaggggagaagagagatggaaaacatggcaaaaaaaca
gccgaggaggtgaagttagccaaagagagagaggaggagaaacaggagaagaaaaccatg
gaggaggaggaggatgctgacgagcagaagcctactggtgctgaatctgagcatgatgca
gaggaggacgttgaccaacagaaacccattggctctgaattggagcacaatacaaaggaa
gatgatcagcagtccggaagcgctgaggggaagcagtcaccgagtgtggggaacacgccc
attaaggctaatggcaagcagcaggagacccagagcctggtgtcaacgccttgtacaggg
acccccacaagcaggacctcacctcaggaaagtcctgccttgtccgactcgccaggcgtc
tctccctccgggatccccaaacgcaggacagcacggaagcagctcccgaaacgcaagctg
gactccacggtcaggtcgagttccaacagctccgagtctggctccccgagcaacaaggcc
gtgaggctggcggagacagatgaagaaaagggtgaagaaaaagcggagccagaggagtgg
caggaagaggaaatggagattggagaggtcaaagggcagtcttctcctgagcagcaggat
gccggaacaaatggagagaagggaggtggggatgaaagtaagaggagggtagaggagaag
cagcaggaggaggagagggagagtgacagcgagggttctccaaagattaaaacagaggag
aaagtggaggaggaggagaaaagtgtggaaaaggccaaagttcccatcagtagcttcttt
gctcccagaaaaccagcaatgaaactagagaagaaggaagaggcggggcttgagaaagca
gccaatcagagtaaagctccagagaccagcaacaaaggaaataaaacagccaacttcttt
gggggagctaagtcggatgcatctcaagagtcggcgtctgaatacaatccatcgaaggct
cgttaccatccggtggacaatgcctgctggagccacggagagaaggttccttatttggct
gtttctcgtacatttgagaaaattgaggaggagtctgccagattgaaaaacattgagacg
ttgagtaactttcttcgctctgtcatcgtgctctcccccaacgacctactgccctgcatc
tacctctgcctaaaccgcctcggacctgcctatgaggggctggagctgggaattggcgag
accatcctcatgagggctgttgcccaggcaactggccgtcagctggagaagatcaaggcg
gaagcacaggagaaaggtgacctgggattggtggcagagagcagccgcagtaaccagcgg
accatgttcacaccacccaaacttgctgccagtggtgtctttgccaagctgaaggagatt
gggaaaatgaccggcagtgcgtctatgaataagaagattgatattattaagggaatgttt
gtggcctgtcgtcactcggaggctcgatacatcatccggtctctgggaggcaagctgcgt
attggactggcggagcagtctgtcttggccgctattgcacaggcggtatgtttgacaccc
ccaggacaagagttccctccaaaggtggtggatgcagggaagggaataacatctgaatca
cgaaaatcctggattgaggagaaagccctgatcctcaaacagacctactgtgagcttccc
agctatgacgtgattgtgccggtcctgctgaaggaggggatagaagaattaccaaaacac
tgtaaactgacgccgggaatccccttgaagccgatgttggctcatcctacgaaggggatt
ggcgaggtgctgaaacgattcgatgaggcagccttcacctgcgaatacaagtatgacggg
gagcgtgcccagatccatattctggagagtggagaggttcatgtttatagccgaaaccag
gagaacaacacatccaaatatccagatattatcgacaggatcccgaaggtgaagaaggat
cacgttacatcatgcatcattgattcagagacggtggcctgggaccctgagaagaaacag
atccaacccttccaggttctgaccacccggaaacgcaaggatgtggatgccacggagatt
aaagtccaggtgtgcgtgtttgcctttgatctgttgtatctcaatggagagtccctggtg
aaagagcccttcgtgaagcggcgggagctgctgagacaagccttcacagagactgaggga
gagttcatgtttgccaccgccatggttggttccaacactgaggagatcgcagacttcctg
gagcagtccattaaagactcatgtgaagggctgatggtgaagaccctggaggtagatgcc
acgtacgaaatagccaagaggtcccacaactggctgaagctgaagaaggattacctggaa
ggggtgggcgacacattggacttggtggtaattggagcatacctggggaagggaaaacgt
gctggtgcctacgggggcttcctgcttgcctgctatgatgatgaaaatgaggaattccag
tccatctgcaagattggtacagggttcaaagatgaagatttggaacaacatcacagcttt
ctgaaggagcatgtgatagataagccccgctcctattttcgctgggacagctctgcagaa
ccggaccattggttcgacccaacacaggtctgggaagtgaagtgtgcggacctctccatc
tctccggtgcacaaggcagctgtgggactggtagatgaagataagggaatctcactgcgt
tttccacgattcttgcgtatccgtgatgacaagaaaccagaggatgccaccaccagttca
caggttgcggatctgtatagaaaacagcagcaaatacaaaaccagcaaaatggagccgag
aagactgaggaggactattactag

DBGET integrated database retrieval system