KEGG   Latimeria chalumnae (coelacanth): 102367184
Entry
102367184         CDS       T02913                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102367184 (TGFA)
   04012 ErbB signaling pathway
    102367184 (TGFA)
SSDB
Motif
Pfam: TMEM154 Ninjurin Insulin_TMD
Other DBs
NCBI-GeneID: 102367184
NCBI-ProteinID: XP_005988279
LinkDB
Position
Un
AA seq 159 aa
MCASFGELFLTLSGLLLAVCHALENSTSTLSSPPVAAAVRSHFSDCPDSHHQFCFHGTCR
FLVQEDSPACVCYSGFVGVRCEHPDLLAVISNNQNGPTITTLVVVLVVTSVFLILLCVLI
HCCMKRKKCEWCRDTVCRHMQPGCLLSGGDSCCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atgtgcgcttcatttggggagcttttcttaacgttgtcgggacttttattagctgtttgc
catgctttggaaaactccacatcaaccttaagtagtcccccagtagctgctgcagtacgc
tctcacttcagcgactgtcctgactctcaccatcaattctgtttccatggaacatgcagg
tttctggttcaggaggattccccagcctgtgtttgctactctgggtttgttggcgttcgg
tgtgagcatccagatcttcttgccgttatatcgaacaatcagaatggaccaacaataact
accttggtggtagtcttggtggtcacatcggtcttcctcattttactctgcgttctaata
cactgctgtatgaaacgaaagaaatgcgagtggtgcagggatactgtttgtcgacacatg
cagcccggctgcctcttaagtggtggagactcctgctgtcattcagagactgtagtatga

DBGET integrated database retrieval system