KEGG   Latimeria chalumnae (coelacanth): 102367471
Entry
102367471         CDS       T02913                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04310  Wnt signaling pathway
lcm04340  Hedgehog signaling pathway
lcm04371  Apelin signaling pathway
lcm04510  Focal adhesion
lcm04530  Tight junction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102367471
   04340 Hedgehog signaling pathway
    102367471
   04371 Apelin signaling pathway
    102367471
   04068 FoxO signaling pathway
    102367471
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102367471
   04115 p53 signaling pathway
    102367471
   04218 Cellular senescence
    102367471
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102367471
   04530 Tight junction
    102367471
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102367471
NCBI-ProteinID: XP_006012922
Ensembl: ENSLACG00000001876
LinkDB
Position
Un
AA seq 292 aa
MELHHQLLCLEVGDLPRAQRDPVLLETRTLWKLLQVEGRYLPSASYFQNVQREIQPGMRK
VLTGWMLEVCEEQDYEEIFPLAVNCLDRFLSLISLEKSQLQLLGSTCLFLASKLKETNPL
MAETLCAYSDFSFTYQELKSMEVVVLKRLKWDLAAVSPQDFLPFLLHQLPCLSEKRGLVL
KHTYTFIALCTTDHNFIAFPPSVVAAASLLSSVCGLQLHHLWGPSSCQGLIQLFACTIRC
DPEFLEACQEQLERILESSLRQAQWSRIPEAKSAREPERSSTPTDVRDINLL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagctgcaccaccagctgctgtgtttggaggtgggagacttgcccagagcgcagagg
gacccagtattgctggagactcgaaccctgtggaagctgctgcaggtggaggggcgatac
ctgccctctgcctcctatttccagaatgtgcagagagaaattcagcccggcatgcgcaaa
gttttaactggctggatgctagaggtgtgcgaggagcaggattatgaggaaatattcccg
ctggcggtgaattgtctggataggttcttgtctctcatctccctggagaaatcgcagctc
cagctgctgggatccacctgccttttcctggcctccaagctgaaggaaacgaatccgctg
atggccgagacactctgtgcttactccgacttctccttcacataccaggaactcaagtcg
atggaggttgtggttctgaagagactgaagtgggacctggccgctgtctccccccaggat
tttctgccgttcctattacaccagctgccttgtctcagtgagaaaaggggactcgtcctc
aaacacacctacaccttcatcgctctctgcactacagatcacaacttcatagcatttcca
ccatctgtggttgcggccgccagcctcttatcgtctgtctgcgggcttcaactccaccac
ctctggggtccttcctcctgccaagggctcatacagctttttgcttgtaccatcagatgt
gacccagagttccttgaagcctgtcaggaacagctggagagaatcctggagtccagccta
cggcaagcccagtggagcagaattcctgaagccaaatccgcacgggagccagagcgctcc
agcacacccaccgacgtccgggatatcaatctgctgtaa

DBGET integrated database retrieval system