KEGG   Latimeria chalumnae (coelacanth): 102367535
Entry
102367535         CDS       T02913                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
lcm  Latimeria chalumnae (coelacanth)
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2 DUF5663
Other DBs
NCBI-GeneID: 102367535
NCBI-ProteinID: XP_005987076
Ensembl: ENSLACG00000017612
UniProt: H3BDR5
LinkDB
Position
Un
AA seq 269 aa
MCEFEMTWSSSASSTASSGYCSQEDSDSELEQFFTARTSFGRKPRRCLQDELIDWEKQPL
SQSEIEQKVKEYNTQINSNLFMTLGKDGSYTGFVKVQLKLVRPVSVPANKKPSVYNAKQT
STRSQAVKRRTSFYLPKDTFKHLHISSKTKASEVIEALLKKFMVVDNPRKFALFERAEKE
DQVYLRKLSDEERPLYLRLLAGPNEKTLSFVLKENETGEVNWDAFSMPELSNFLRILQRE
EEEHVKQILQKYTRCREKIQEALGARSPG
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtgcgagttcgagatgacgtggagcagcagcgcgagcagcacggccagcagcggctat
tgtagccaggaggattcggactcggaactcgagcagttcttcaccgcgcgcacgtccttc
ggcaggaagccccgccgctgccttcaggatgaactgatagactgggagaagcagcctttg
tctcagagtgagattgagcagaaggtaaaggagtacaacacacagatcaacagcaacctt
tttatgactctgggcaaagatggctcttatacaggatttgttaaggtacagctgaagttg
gtgcgccctgtgtctgtacctgcgaataaaaagccatctgtttataatgcaaagcaaaca
tccacacggtcccaggcagtgaaaagacgcacttccttttatctcccaaaagacaccttt
aaacacttgcacatcagttccaagacaaaggccagtgaggttattgaggcactcctaaag
aagtttatggtagttgataaccctcggaaatttgcactgtttgaacgagcagagaaggaa
gatcaagtttacctgcgtaaactctccgatgaagagcgtcccctctacctgcgtctcttg
gctggaccaaatgagaagaccttgagctttgtgctaaaagagaacgagactggagaagtt
aattgggatgccttttcaatgcctgagctcagtaacttcctacggattctgcagcgcgag
gaagaggagcatgtcaaacagatcctccaaaaatacacacgctgtcgggagaagatacag
gaggccctaggtgctcgttcccctggctga

DBGET integrated database retrieval system