KEGG   Latimeria chalumnae (coelacanth): 106705214
Entry
106705214         CDS       T02913                                 

Definition
(RefSeq) interferon-activable protein 204-like
  KO
K12966  absent in melanoma 2
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04621  NOD-like receptor signaling pathway
lcm04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106705214
   04623 Cytosolic DNA-sensing pathway
    106705214
SSDB
Motif
Pfam: HIN
Other DBs
NCBI-GeneID: 106705214
NCBI-ProteinID: XP_014349488
LinkDB
Position
Un
AA seq 241 aa
MPRGKRSASRNRAPAAKRSKKTSASRNTMPVAIQVGDLKEFCQNHKGYIKDRSIHVTVIK
SYMIFSYPDRRPKTSWGKRTRNSMFYAILADESGFLVAKVFDTTAKRYFSKDGCLAITDF
QYRDGFVEVTIRTILKKLAKSAVKVPDEISDNGKKGITVEEIKSLPLNTVVNGSFNVLKY
RTSNNRLHMTVEDTTGEVNVTIVHQPRKVTPKKGKMSLMCFRIKNYRGHRQLTSTPQSFA
Q
NT seq 726 nt   +upstreamnt  +downstreamnt
atgccaagagggaaaagaagtgcctcccgcaatagggctcctgctgctaagagatcgaag
aaaacctcagcatcacggaacactatgcctgtggcaatccaagtgggtgatctcaaagaa
ttctgtcaaaaccataagggttatataaaagatcggagcattcatgtcacagtgatcaag
tcctatatgatcttcagctacccagaccgcaggccaaaaacctcttggggcaagcgcacc
cgaaacagcatgttctacgccattctggcagatgagtccggcttcctcgtggcgaaggtc
ttcgacacgacagcaaagagatacttctctaaggacggctgccttgccatcactgacttc
cagtaccgtgatgggtttgtggaagtgacgatccgcacaatcttgaagaagctggccaag
tctgctgtgaaagtgccagacgagatcagcgacaatgggaaaaagggcatcactgtagaa
gaaatcaagagcttgcctctgaacaccgttgtcaatggatcattcaatgttcttaagtat
cgcacctcaaataacagactccacatgaccgtagaagatacaactggtgaagtgaatgtt
accattgtccaccagccacgcaaggtcactccgaagaaagggaagatgtccttgatgtgt
ttccgaataaaaaactacaggggacatcgtcagctgacatccactccacagtcctttgct
cagtga

DBGET integrated database retrieval system